Chorismate synthase

Details

Name
Chorismate synthase
Synonyms
  • 4.2.3.5
  • 5-enolpyruvylshikimate-3-phosphate phospholyase
  • CS
Gene Name
aroC
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Amino acid sequence
>lcl|BSEQ0016612|Chorismate synthase
MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIENDQVVFTS
GVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYR
FDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEI
KQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLD
ARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTN
GQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQ
EILEKFSSDNLEELKEAVAKHRDYTKNY
Number of residues
388
Molecular Weight
42871.475
Theoretical pI
6.14
GO Classification
Functions
chorismate synthase activity
Processes
aromatic amino acid family biosynthetic process / chorismate biosynthetic process
General Function
Chorismate synthase activity
Specific Function
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016613|Chorismate synthase (aroC)
ATGAGATATTTAACTGCAGGAGAATCACACGGCCCCCGTCTAACAGCTATTATTGAGGGA
ATTCCAGCTGGACTTCCATTGACAGCTGAGGATATCAATGAGGACCTTAGACGCCGTCAG
GGTGGCTACGGTCGTGGTGGTCGTATGAAGATTGAGAATGACCAGGTTGTCTTTACTTCG
GGCGTTCGCCACGGGAAGACGACAGGGGCGCCTATTACTATGGATGTCATCAATAAGGAC
CACCAGAAATGGCTGGACATCATGTCTGCGGAGGACATTGAAGACCGCCTTAAAAGCAAG
CGGAAAATTACTCATCCTCGCCCAGGTCATGCCGATTTGGTTGGGGGGATTAAGTACCGT
TTTGATGATTTGCGAAATTCTTTGGAGCGTTCATCAGCTCGTGAAACCACCATGCGGGTG
GCAGTTGGTGCAGTAGCCAAACGCCTCTTGGCTGAGCTGGATATGGAGATTGCCAACCAT
GTCGTGGTCTTTGGTGGTAAGGAAATCGATGTTCCTGAAAATCTGACAGTCGCTGAAATT
AAGCAAAGAGCTGCCCAGTCTGAAGTTTCTATTGTCAACCAAGAACGAGAACAGGAAATC
AAGGACTATATTGACCAAATCAAACGTGATGGTGATACCATCGGTGGGGTTGTGGAGACA
GTCGTCGGAGGCGTTCCAGTTGGTCTTGGTTCCTATGTCCAATGGGATAGAAAATTGGAT
GCAAGATTGGCTCAAGCTGTTGTCTCTATCAATGCCTTTAAAGGGGTGGAATTTGGTCTT
GGCTTTGAGGCTGGTTATCGTAAAGGCAGCCAAGTTATGGATGAAATTCTCTGGTCTAAA
GAAGACGGTTATACTCGCCGTACCAATAATCTAGGTGGTTTTGAAGGTGGTATGACTAAT
GGGCAACCCATCGTTGTTCGTGGGGTCATGAAACCTATTCCTACTCTTTATAAACCTCTT
ATGAGTGTGGATATCGAAACCCACGAACCTTACAAGGCAACCGTGGAGAGAAGCGATCCG
ACTGCTCTTCCAGCTGCAGGAATGGTCATGGAAGCAGTTGTAGCAACGGTTCTGGCGCAA
GAAATCCTCGAAAAATTCTCATCAGATAATCTTGAGGAACTAAAAGAAGCGGTAGCCAAA
CACCGAGACTATACAAAGAACTATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A2Y7
UniProtKB Entry NameAROC_STRR6
GenBank Protein ID15458869
GenBank Gene IDAE008495
General References
  1. Hoskins J, Alborn WE Jr, Arnold J, Blaszczak LC, Burgett S, DeHoff BS, Estrem ST, Fritz L, Fu DJ, Fuller W, Geringer C, Gilmour R, Glass JS, Khoja H, Kraft AR, Lagace RE, LeBlanc DJ, Lee LN, Lefkowitz EJ, Lu J, Matsushima P, McAhren SM, McHenney M, McLeaster K, Mundy CW, Nicas TI, Norris FH, O'Gara M, Peery RB, Robertson GT, Rockey P, Sun PM, Winkler ME, Yang Y, Young-Bellido M, Zhao G, Zook CA, Baltz RH, Jaskunas SR, Rosteck PR Jr, Skatrud PL, Glass JI: Genome of the bacterium Streptococcus pneumoniae strain R6. J Bacteriol. 2001 Oct;183(19):5709-17. [PubMed:11544234]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails
DB03350Cobalt hexammine ionexperimentalunknownDetails