Thymidylate kinase

Details

Name
Thymidylate kinase
Synonyms
  • 2.7.4.9
  • dTMP kinase
  • Thymidine monophosphate kinase
  • TMPK
Gene Name
tmk
Organism
Shigella flexneri
Amino acid sequence
>lcl|BSEQ0011391|Thymidylate kinase
MRSKYIVIEGLEGAGKTTARNVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLVLDIKSV
GDEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHML
ATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIEQESFDFFNRTRARYLELAAQ
DKSIHTIDATQPLEAVMDAIRTTVTHWVKELDA
Number of residues
213
Molecular Weight
23782.93
Theoretical pI
5.16
GO Classification
Functions
ATP binding / thymidylate kinase activity
Processes
dTDP biosynthetic process / dTTP biosynthetic process
General Function
Thymidylate kinase activity
Specific Function
Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011392|Thymidylate kinase (tmk)
ATGCGCAGTAAGTATATCGTCATTGAGGGGCTGGAAGGCGCAGGCAAAACTACCGCGCGT
AATGTGGTGGTTGAGACGCTCGAGCAACTGGGTATCCGCGACATGGTTTTCACTCGGGAA
CCTGGCGGTACGCAACTTGCCGAAAAGTTAAGAAGCCTGGTGCTGGATATCAAATCGGTA
GGCGATGAAGTCATTACCGATAAAGCCGAAGTTCTGATGTTTTATGCCGCGCGCGTTCAA
CTGGTAGAAACGGTCATCAAACCTGCGCTGGCTAACGGCACCTGGGTGATTGGCGATCGC
CACGATCTTTCCACTCAGGCGTATCAGGGCGGAGGACGTGGTATTGACCAACATATGCTG
GCAACACTGCGTGATGCTGTTCTCGGGGATTTTCGCCCAGACTTAACGCTCTATCTCGAT
GTTACCCCGGAAGTTGGCTTAAAACGCGCGCGTGCGCGCGGCGAGCTGGATCGTATTGAG
CAAGAGTCTTTCGATTTCTTTAATCGCACCCGCGCCCGCTATCTGGAACTGGCTGCACAA
GATAAAAGTATTCATACCATTGATGCCACCCAGCCGCTGGAGGCCGTGATGGATGCAATC
CGCACTACCGTGACCCACTGGGTGAAGGAGTTGGACGCATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A721
UniProtKB Entry NameKTHY_SHIFL
GenBank Protein ID24051392
GenBank Gene IDAE005674
General References
  1. Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J, Yang F, Zhang X, Zhang J, Yang G, Wu H, Qu D, Dong J, Sun L, Xue Y, Zhao A, Gao Y, Zhu J, Kan B, Ding K, Chen S, Cheng H, Yao Z, He B, Chen R, Ma D, Qiang B, Wen Y, Hou Y, Yu J: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157. Nucleic Acids Res. 2002 Oct 15;30(20):4432-41. [Article]
  2. Wei J, Goldberg MB, Burland V, Venkatesan MM, Deng W, Fournier G, Mayhew GF, Plunkett G 3rd, Rose DJ, Darling A, Mau B, Perna NT, Payne SM, Runyen-Janecky LJ, Zhou S, Schwartz DC, Blattner FR: Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T. Infect Immun. 2003 May;71(5):2775-86. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03280p1-(5'-adenosyl)p5-(5'-thymidyl)pentaphosphateexperimentalunknownDetails