30S ribosomal protein S10
Details
- Name
- 30S ribosomal protein S10
- Synonyms
- nusE
- Gene Name
- rpsJ
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0010182|30S ribosomal protein S10 MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD ARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
- Number of residues
- 103
- Molecular Weight
- 11735.47
- Theoretical pI
- 10.34
- GO Classification
- Functionsstructural constituent of ribosome / tRNA bindingProcessestranslationComponentscytosol / cytosolic small ribosomal subunit
- General Function
- Trna binding
- Specific Function
- Involved in the binding of tRNA to the ribosomes.
- Pfam Domain Function
- Ribosomal_S10 (PF00338)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0010183|30S ribosomal protein S10 (rpsJ) ATGCAGAACCAAAGAATCCGTATCCGCCTGAAAGCGTTTGATCATCGTCTGATCGATCAA GCAACCGCGGAAATCGTCGAGACTGCCAAGCGCACTGGTGCGCAGGTCCGTGGTCCGATC CCGCTGCCGACACGCAAAGAGCGCTTCACTGTTCTGATCTCCCCGCACGTCAACAAAGAC GCGCGCGATCAGTACGAAATCCGTACTCACTTGCGTCTGGTTGACATCGTTGAGCCAACC GAGAAAACCGTTGATGCTCTGATGCGTCTGGATCTGGCTGCCGGTGTAGACGTGCAGATC AGCCTGGGTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A7R5 UniProtKB Entry Name RS10_ECOLI GenBank Protein ID 42857 GenBank Gene ID V00344 - General References
- Yaguchi M, Roy C, Wittmann HG: The primary structure of protein S10 from the small ribosomal subunit of Escherichia coli. FEBS Lett. 1980 Nov 17;121(1):113-6. [Article]
- Olins PO, Nomura M: Regulation of the S10 ribosomal protein operon in E. coli: nucleotide sequence at the start of the operon. Cell. 1981 Oct;26(2 Pt 2):205-11. [Article]
- Zurawski G, Zurawski SM: Structure of the Escherichia coli S10 ribosomal protein operon. Nucleic Acids Res. 1985 Jun 25;13(12):4521-6. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Link AJ, Robison K, Church GM: Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis. 1997 Aug;18(8):1259-313. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]