30S ribosomal protein S10

Details

Name
30S ribosomal protein S10
Synonyms
  • nusE
Gene Name
rpsJ
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0010182|30S ribosomal protein S10
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Number of residues
103
Molecular Weight
11735.47
Theoretical pI
10.34
GO Classification
Functions
structural constituent of ribosome / tRNA binding
Processes
translation
Components
cytosol / cytosolic small ribosomal subunit
General Function
Trna binding
Specific Function
Involved in the binding of tRNA to the ribosomes.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0010183|30S ribosomal protein S10 (rpsJ)
ATGCAGAACCAAAGAATCCGTATCCGCCTGAAAGCGTTTGATCATCGTCTGATCGATCAA
GCAACCGCGGAAATCGTCGAGACTGCCAAGCGCACTGGTGCGCAGGTCCGTGGTCCGATC
CCGCTGCCGACACGCAAAGAGCGCTTCACTGTTCTGATCTCCCCGCACGTCAACAAAGAC
GCGCGCGATCAGTACGAAATCCGTACTCACTTGCGTCTGGTTGACATCGTTGAGCCAACC
GAGAAAACCGTTGATGCTCTGATGCGTCTGGATCTGGCTGCCGGTGTAGACGTGCAGATC
AGCCTGGGTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A7R5
UniProtKB Entry NameRS10_ECOLI
GenBank Protein ID42857
GenBank Gene IDV00344
General References
  1. Yaguchi M, Roy C, Wittmann HG: The primary structure of protein S10 from the small ribosomal subunit of Escherichia coli. FEBS Lett. 1980 Nov 17;121(1):113-6. [Article]
  2. Olins PO, Nomura M: Regulation of the S10 ribosomal protein operon in E. coli: nucleotide sequence at the start of the operon. Cell. 1981 Oct;26(2 Pt 2):205-11. [Article]
  3. Zurawski G, Zurawski SM: Structure of the Escherichia coli S10 ribosomal protein operon. Nucleic Acids Res. 1985 Jun 25;13(12):4521-6. [Article]
  4. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
  5. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
  6. Link AJ, Robison K, Church GM: Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis. 1997 Aug;18(8):1259-313. [Article]
  7. VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
  8. Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
  9. Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
  10. Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
  11. Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00698Nitrofurantoinapproved, vet_approvedunknowninhibitorDetails