30S ribosomal protein S13

Details

Name
30S ribosomal protein S13
Synonyms
Not Available
Gene Name
rpsM
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0012584|30S ribosomal protein S13
MARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEV
AKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
Number of residues
118
Molecular Weight
13099.245
Theoretical pI
11.43
GO Classification
Functions
rRNA binding / structural constituent of ribosome / tRNA binding
Processes
translation
Components
cytosol / cytosolic small ribosomal subunit
General Function
Trna binding
Specific Function
Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.In the E.coli 70S ribosome in the initiation state (PubMed:12809609) was modeled to contact the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; bridge B1a is broken in the model with bound EF-G, while the protein-protein contacts between S13 and L5 in B1b change (PubMed:12809609). The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states (PubMed:16272117), contacting alternately S13 or S19. In the two 3.5 angstroms resolved ribosome structures (PubMed:12859903) the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder.Contacts the tRNAs in the A and P sites.The C-terminal tail plays a role in the affinity of the 30S P site for different tRNAs.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0012585|30S ribosomal protein S13 (rpsM)
GTGGCCCGTATAGCAGGCATTAACATTCCTGATCATAAGCATGCCGTAATCGCATTAACT
TCGATTTATGGCGTCGGCAAGACCCGTTCTAAAGCCATCCTGGCTGCAGCGGGTATCGCT
GAAGATGTTAAGATCAGTGAGCTGTCTGAAGGACAAATCGACACGCTGCGTGACGAAGTT
GCCAAATTTGTCGTTGAAGGTGATCTGCGCCGTGAAATCAGCATGAGCATCAAGCGCCTG
ATGGATCTTGGTTGCTATCGCGGTTTGCGTCATCGTCGTGGTCTCCCGGTTCGCGGTCAG
CGTACCAAGACCAACGCACGTACCCGTAAGGGTCCGCGCAAACCGATCAAGAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A7S9
UniProtKB Entry NameRS13_ECOLI
GenBank Protein ID581217
GenBank Gene IDX02543
General References
  1. Bedwell D, Davis G, Gosink M, Post L, Nomura M, Kestler H, Zengel JM, Lindahl L: Nucleotide sequence of the alpha ribosomal protein operon of Escherichia coli. Nucleic Acids Res. 1985 Jun 11;13(11):3891-903. [Article]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
  4. Lindemann H, Wittmann-Liebold B: Primary structure of protein S13 from the small subunit of escherichia coli ribosomes. Hoppe Seylers Z Physiol Chem. 1977 Jul;358(7):843-63. [Article]
  5. Post LE, Arfsten AE, Davis GR, Nomura M: DNA sequence of the promoter region for the alpha ribosomal protein operon in Escherichia coli. J Biol Chem. 1980 May 25;255(10):4653-59. [Article]
  6. Miura A, Krueger JH, Itoh S, de Boer HA, Nomura M: Growth-rate-dependent regulation of ribosome synthesis in E. coli: expression of the lacZ and galK genes fused to ribosomal promoters. Cell. 1981 Sep;25(3):773-82. [Article]
  7. Pohl T, Wittmann-Liebold B: Identification of a cross-link in the Escherichia coli ribosomal protein pair S13-S19 at the amino acid level. J Biol Chem. 1988 Mar 25;263(9):4293-301. [Article]
  8. Faxen M, Walles-Granberg A, Isaksson LA: Antisuppression by a mutation in rpsM(S13) giving a shortened ribosomal protein S13. Biochim Biophys Acta. 1994 May 17;1218(1):27-34. [Article]
  9. Osswald M, Doring T, Brimacombe R: The ribosomal neighbourhood of the central fold of tRNA: cross-links from position 47 of tRNA located at the A, P or E site. Nucleic Acids Res. 1995 Nov 25;23(22):4635-41. [Article]
  10. Bylund GO, Persson BC, Lundberg LA, Wikstrom PM: A novel ribosome-associated protein is important for efficient translation in Escherichia coli. J Bacteriol. 1997 Jul;179(14):4567-74. [Article]
  11. Hoang L, Fredrick K, Noller HF: Creating ribosomes with an all-RNA 30S subunit P site. Proc Natl Acad Sci U S A. 2004 Aug 24;101(34):12439-43. Epub 2004 Aug 12. [Article]
  12. Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
  13. Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
  14. Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
  15. Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]
  16. Valle M, Zavialov A, Sengupta J, Rawat U, Ehrenberg M, Frank J: Locking and unlocking of ribosomal motions. Cell. 2003 Jul 11;114(1):123-34. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00560TigecyclineapprovedyesbinderDetails