30S ribosomal protein S3
Details
- Name
- 30S ribosomal protein S3
- Synonyms
- Not Available
- Gene Name
- rpsC
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0013240|30S ribosomal protein S3 MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
- Number of residues
- 233
- Molecular Weight
- 25983.07
- Theoretical pI
- Not Available
- GO Classification
- FunctionsmRNA binding / rRNA binding / structural constituent of ribosomeProcessestranslationComponentscytosol / cytosolic small ribosomal subunit
- General Function
- Structural constituent of ribosome
- Specific Function
- Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity).Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp.
- Pfam Domain Function
- KH_2 (PF07650)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0013241|30S ribosomal protein S3 (rpsC) ATGGGTCAGAAAGTACATCCTAATGGTATTCGCCTGGGTATTGTAAAACCATGGAACTCT ACCTGGTTTGCGAACACCAAAGAATTCGCTGACAACCTGGACAGCGATTTTAAAGTACGT CAGTACCTGACTAAGGAACTGGCTAAAGCGTCCGTATCTCGTATCGTTATCGAGCGTCCG GCTAAGAGCATCCGTGTAACCATTCACACTGCTCGCCCGGGTATCGTTATCGGTAAAAAA GGTGAAGACGTAGAAAAACTGCGTAAGGTCGTAGCGGACATCGCTGGCGTTCCTGCACAG ATCAACATCGCCGAAGTTCGTAAGCCTGAACTGGACGCAAAACTGGTTGCTGACAGCATC ACTTCTCAGCTGGAACGTCGCGTTATGTTCCGTCGTGCTATGAAGCGTGCTGTACAGAAC GCAATGCGTCTGGGCGCTAAAGGTATTAAAGTTGAAGTTAGCGGCCGTCTGGGCGGCGCG GAAATCGCACGTACCGAATGGTACCGCGAAGGTCGCGTACCGCTGCACACTCTGCGTGCT GACATCGACTACAACACCTCTGAAGCGCACACCACTTACGGTGTAATCGGCGTTAAAGTG TGGATCTTCAAAGGCGAGATCCTGGGTGGTATGGCTGCTGTTGAACAACCGGAAAAACCG GCTGCTCAGCCTAAAAAGCAGCAGCGTAAAGGCCGTAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A7V3 UniProtKB Entry Name RS3_ECOLI - General References
- Zurawski G, Zurawski SM: Structure of the Escherichia coli S10 ribosomal protein operon. Nucleic Acids Res. 1985 Jun 25;13(12):4521-6. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Brauer D, Roming R: The primary structure of protein S3 from the small ribosomal subunit of Escherichia coli. FEBS Lett. 1979 Oct 15;106(2):352-7. [Article]
- Urlaub H, Kruft V, Bischof O, Muller EC, Wittmann-Liebold B: Protein-rRNA binding features and their structural and functional implications in ribosomes as determined by cross-linking studies. EMBO J. 1995 Sep 15;14(18):4578-88. [Article]
- Choi KM, Atkins JF, Gesteland RF, Brimacombe R: Flexibility of the nascent polypeptide chain within the ribosome--contacts from the peptide N-terminus to a specific region of the 30S subunit. Eur J Biochem. 1998 Jul 15;255(2):409-13. [Article]
- Takyar S, Hickerson RP, Noller HF: mRNA helicase activity of the ribosome. Cell. 2005 Jan 14;120(1):49-58. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]