Fumarate reductase subunit D
Details
- Name
- Fumarate reductase subunit D
- Synonyms
- Fumarate reductase 13 kDa hydrophobic protein
- Gene Name
- frdD
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0012756|Fumarate reductase subunit D MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
- Number of residues
- 119
- Molecular Weight
- 13106.81
- Theoretical pI
- 9.26
- GO Classification
- Functionssuccinate dehydrogenase (ubiquinone) activity / succinate dehydrogenase activityProcessesanaerobic respiration / fermentation / fumarate metabolic processComponentsintegral component of plasma membrane / plasma membrane / plasma membrane fumarate reductase complex
- General Function
- Succinate dehydrogenase activity
- Specific Function
- Seems to be involved in the anchoring of the catalytic components of the fumarate reductase complex to the cytoplasmic membrane.
- Pfam Domain Function
- Fumarate_red_D (PF02313)
- Transmembrane Regions
- 9-35 61-89 97-115
- Cellular Location
- Cell inner membrane
- Gene sequence
>lcl|BSEQ0012757|Fumarate reductase subunit D (frdD) ATGATTAATCCAAATCCAAAGCGTTCTGACGAACCGGTATTCTGGGGCCTCTTCGGGGCC GGTGGTATGTGGAGCGCCATCATTGCGCCGGTGATGATCCTGCTGGTGGGTATTCTGCTG CCACTGGGGTTGTTTCCGGGTGATGCGCTGAGCTACGAGCGCGTTCTGGCGTTCGCGCAG AGCTTCATTGGTCGCGTATTCCTGTTCCTGATGATCGTTCTGCCGCTGTGGTGTGGTTTA CACCGTATGCACCACGCGATGCACGATCTGAAAATCCACGTACCTGCGGGCAAATGGGTT TTCTACGGTCTGGCTGCTATCCTGACAGTTGTCACGCTGATTGGTGTCGTTACAATCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A8Q3 UniProtKB Entry Name FRDD_ECOLI GenBank Protein ID 7019629 GenBank Gene ID J01611 - General References
- Grundstrom T, Jaurin B: Overlap between ampC and frd operons on the Escherichia coli chromosome. Proc Natl Acad Sci U S A. 1982 Feb;79(4):1111-5. [Article]
- Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR: Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Nucleic Acids Res. 1995 Jun 25;23(12):2105-19. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Olsson O, Bergstrom S, Lindberg FP, Normark S: ampC beta-lactamase hyperproduction in Escherichia coli: natural ampicillin resistance generated by horizontal chromosomal DNA transfer from Shigella. Proc Natl Acad Sci U S A. 1983 Dec;80(24):7556-60. [Article]
- Jones HM, Gunsalus RP: Transcription of the Escherichia coli fumarate reductase genes (frdABCD) and their coordinate regulation by oxygen, nitrate, and fumarate. J Bacteriol. 1985 Dec;164(3):1100-9. [Article]
- Yi X, Mroczko M, Manoj KM, Wang X, Hager LP: Replacement of the proximal heme thiolate ligand in chloroperoxidase with a histidine residue. Proc Natl Acad Sci U S A. 1999 Oct 26;96(22):12412-7. [Article]
- Daley DO, Rapp M, Granseth E, Melen K, Drew D, von Heijne G: Global topology analysis of the Escherichia coli inner membrane proteome. Science. 2005 May 27;308(5726):1321-3. [Article]
- Iverson TM, Luna-Chavez C, Cecchini G, Rees DC: Structure of the Escherichia coli fumarate reductase respiratory complex. Science. 1999 Jun 18;284(5422):1961-6. [Article]
- Iverson TM, Luna-Chavez C, Croal LR, Cecchini G, Rees DC: Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site. J Biol Chem. 2002 May 3;277(18):16124-30. Epub 2002 Feb 15. [Article]