Hypoxanthine phosphoribosyltransferase

Details

Name
Hypoxanthine phosphoribosyltransferase
Synonyms
  • 2.4.2.8
  • HPRT
Gene Name
hpt
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0011507|Hypoxanthine phosphoribosyltransferase
MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGSFMFMADLCREVQVSH
EVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREP
KSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIGKVILLDE
Number of residues
178
Molecular Weight
20115.025
Theoretical pI
4.82
GO Classification
Functions
guanine phosphoribosyltransferase activity / hypoxanthine phosphoribosyltransferase activity / magnesium ion binding / nucleotide binding
Processes
adenine salvage / GMP salvage / guanine salvage / hypoxanthine metabolic process / IMP salvage
Components
cytosol
General Function
Nucleotide binding
Specific Function
Acts preferentially on hypoxanthine; has very low activity towards guanine. Inactive towards xanthine.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011508|Hypoxanthine phosphoribosyltransferase (hpt)
ATGAAACATACTGTAGAAGTAATGATCCCCGAAGCGGAGATTAAAGCGCGTATCGCCGAA
CTGGGTCGTCAGATTACTGAGCGTTACAAAGACAGCGGCAGCGATATGGTGCTGGTGGGT
CTGCTGCGTGGCTCATTTATGTTTATGGCGGACCTGTGCCGTGAAGTTCAGGTATCTCAT
GAAGTCGACTTTATGACCGCCTCCAGCTACGGTAGCGGCATGTCCACCACCCGTGATGTG
AAAATCCTCAAAGATCTGGATGAAGATATCCGTGGCAAGGACGTGCTGATTGTTGAAGAT
ATCATCGACTCGGGGAATACACTGTCGAAAGTGCGTGAGATCTTAAGCCTGCGCGAACCG
AAGTCGCTGGCGATTTGTACGCTGCTGGATAAACCGTCCCGTCGTGAAGTGAACGTCCCG
GTAGAATTTATCGGTTTCTCGATCCCGGATGAGTTTGTGGTGGGTTACGGCATTGATTAC
GCACAGCGTTACCGTCATCTGCCGTATATCGGCAAAGTGATTCTGCTGGACGAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A9M2
UniProtKB Entry NameHPRT_ECOLI
GenBank Gene IDU00096
General References
  1. Fujita N, Mori H, Yura T, Ishihama A: Systematic sequencing of the Escherichia coli genome: analysis of the 2.4-4.1 min (110,917-193,643 bp) region. Nucleic Acids Res. 1994 May 11;22(9):1637-9. [PubMed:8202364]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  4. Guddat LW, Vos S, Martin JL, Keough DT, de Jersey J: Crystal structures of free, IMP-, and GMP-bound Escherichia coli hypoxanthine phosphoribosyltransferase. Protein Sci. 2002 Jul;11(7):1626-38. [PubMed:12070315]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04566Inosinic AcidexperimentalunknownDetails