Xanthine phosphoribosyltransferase
Details
- Name
- Xanthine phosphoribosyltransferase
- Synonyms
- 2.4.2.22
- gpp
- gxu
- Xanthine-guanine phosphoribosyltransferase
- XGPRT
- Gene Name
- gpt
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0011448|Xanthine phosphoribosyltransferase MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI SSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRP LVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
- Number of residues
- 152
- Molecular Weight
- 16970.455
- Theoretical pI
- 5.63
- GO Classification
- Functionshypoxanthine phosphoribosyltransferase activity / magnesium ion binding / xanthine phosphoribosyltransferase activityProcessesGMP salvage / IMP salvage / XMP salvageComponentscytosol / plasma membrane
- General Function
- Xanthine phosphoribosyltransferase activity
- Specific Function
- Acts on guanine, xanthine and to a lesser extent hypoxanthine.
- Pfam Domain Function
- Pribosyltran (PF00156)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell inner membrane
- Gene sequence
>lcl|BSEQ0011449|Xanthine phosphoribosyltransferase (gpt) ATGAGCGAAAAATACATCGTCACCTGGGACATGTTGCAGATCCATGCACGTAAACTCGCA AGCCGACTGATGCCTTCTGAACAATGGAAAGGCATTATTGCCGTAAGCCGTGGCGGTCTG GTACCGGGTGCGTTACTGGCGCGTGAACTGGGTATTCGTCATGTCGATACCGTTTGTATT TCCAGCTACGATCACGACAACCAGCGCGAGCTTAAAGTGCTGAAACGCGCAGAAGGCGAT GGCGAAGGCTTCATCGTTATTGATGACCTGGTGGATACCGGTGGTACTGCGGTTGCGATT CGTGAAATGTATCCAAAAGCGCACTTTGTCACCATCTTCGCAAAACCGGCTGGTCGTCCG CTGGTTGATGACTATGTTGTTGATATCCCGCAAGATACCTGGATTGAACAGCCGTGGGAT ATGGGCGTCGTATTCGTCCCGCCAATCTCCGGTCGCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A9M5 UniProtKB Entry Name XGPT_ECOLI GenBank Protein ID 41607 GenBank Gene ID X00221 - General References
- Pratt D, Subramani S: Nucleotide sequence of the Escherichia coli xanthine-guanine phosphoribosyl transferase gene. Nucleic Acids Res. 1983 Dec 20;11(24):8817-23. [Article]
- Richardson KK, Fostel J, Skopek TR: Nucleotide sequence of the xanthine guanine phosphoribosyl transferase gene of E. coli. Nucleic Acids Res. 1983 Dec 20;11(24):8809-16. [Article]
- Nuesch J, Schumperli D: Structural and functional organization of the gpt gene region of Escherichia coli. Gene. 1984 Dec;32(1-2):243-9. [Article]
- Jagadeeswaran P, Ashman CR, Roberts S, Langenberg J: Nucleotide sequence and analysis of deletion mutants of the Escherichia coli gpt gene in plasmid pSV2 gpt. Gene. 1984 Nov;31(1-3):309-13. [Article]
- Richardson KK, Richardson FC, Crosby RM, Swenberg JA, Skopek TR: DNA base changes and alkylation following in vivo exposure of Escherichia coli to N-methyl-N-nitrosourea or N-ethyl-N-nitrosourea. Proc Natl Acad Sci U S A. 1987 Jan;84(2):344-8. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Mulligan RC, Berg P: Factors governing the expression of a bacterial gene in mammalian cells. Mol Cell Biol. 1981 May;1(5):449-59. [Article]
- Vos S, de Jersey J, Martin JL: Crystal structure of Escherichia coli xanthine phosphoribosyltransferase. Biochemistry. 1997 Apr 8;36(14):4125-34. [Article]
- Deo SS, Tseng WC, Saini R, Coles RS, Athwal RS: Purification and characterization of Escherichia coli xanthine-guanine phosphoribosyltransferase produced by plasmid pSV2gpt. Biochim Biophys Acta. 1985 May 8;839(3):233-9. [Article]
- Vos S, de Jersey J, Martin JL: Crystallization and preliminary X-ray crystallographic studies of Escherichia coli xanthine phosphoribosyltransferase. J Struct Biol. 1996 Mar-Apr;116(2):330-4. [Article]
- Vos S, Parry RJ, Burns MR, de Jersey J, Martin JL: Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase. J Mol Biol. 1998 Oct 2;282(4):875-89. [Article]