Cold shock protein CspA

Details

Name
Cold shock protein CspA
Synonyms
  • 7.4 kDa cold shock protein
  • CS7.4
  • CSP-A
  • cspS
Gene Name
cspA
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0052744|Cold shock protein CspA
MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAK
GPAAGNVTSL
Number of residues
70
Molecular Weight
7403.245
Theoretical pI
Not Available
GO Classification
Functions
DNA binding / nucleic acid binding / RNA binding / single-stranded DNA binding / single-stranded RNA binding / transcription antitermination factor activity, RNA binding
Processes
negative regulation of DNA-templated transcription, termination / regulation of gene expression / response to cold / transcription, DNA-templated
Components
cytosol
General Function
Binds to and stimulates the transcription of the CCAAT-containing, cold-shock-inducible promoters of the H-NS and GyrA proteins. Binds also to the inverted repeat 5'-ATTGG-3'.
Specific Function
Dna binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0052745|Cold shock protein CspA (cspA)
ATGTCCGGTAAAATGACTGGTATCGTAAAATGGTTCAACGCTGACAAAGGCTTCGGCTTC
ATCACTCCTGACGATGGCTCTAAAGATGTGTTCGTACACTTCTCTGCTATCCAGAACGAT
GGTTACAAATCTCTGGACGAAGGTCAGAAAGTGTCCTTCACCATCGAAAGCGGCGCTAAA
GGCCCGGCAGCTGGTAACGTAACCAGCCTGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A9X9
UniProtKB Entry NameCSPA_ECOLI
General References
  1. Goldstein J, Pollitt NS, Inouye M: Major cold shock protein of Escherichia coli. Proc Natl Acad Sci U S A. 1990 Jan;87(1):283-7. doi: 10.1073/pnas.87.1.283. [Article]
  2. Tanabe H, Goldstein J, Yang M, Inouye M: Identification of the promoter region of the Escherichia coli major cold shock gene, cspA. J Bacteriol. 1992 Jun;174(12):3867-73. doi: 10.1128/jb.174.12.3867-3873.1992. [Article]
  3. Sofia HJ, Burland V, Daniels DL, Plunkett G 3rd, Blattner FR: Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes. Nucleic Acids Res. 1994 Jul 11;22(13):2576-86. [Article]
  4. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
  5. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
  6. Francis KP, Stewart GS: Detection and speciation of bacteria through PCR using universal major cold-shock protein primer oligomers. J Ind Microbiol Biotechnol. 1997 Oct;19(4):286-93. doi: 10.1038/sj.jim.2900463. [Article]
  7. La Teana A, Brandi A, Falconi M, Spurio R, Pon CL, Gualerzi CO: Identification of a cold shock transcriptional enhancer of the Escherichia coli gene encoding nucleoid protein H-NS. Proc Natl Acad Sci U S A. 1991 Dec 1;88(23):10907-11. doi: 10.1073/pnas.88.23.10907. [Article]
  8. Jones PG, Inouye M: RbfA, a 30S ribosomal binding factor, is a cold-shock protein whose absence triggers the cold-shock response. Mol Microbiol. 1996 Sep;21(6):1207-18. doi: 10.1111/j.1365-2958.1996.tb02582.x. [Article]
  9. VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
  10. Newkirk K, Feng W, Jiang W, Tejero R, Emerson SD, Inouye M, Montelione GT: Solution NMR structure of the major cold shock protein (CspA) from Escherichia coli: identification of a binding epitope for DNA. Proc Natl Acad Sci U S A. 1994 May 24;91(11):5114-8. doi: 10.1073/pnas.91.11.5114. [Article]
  11. Feng W, Tejero R, Zimmerman DE, Inouye M, Montelione GT: Solution NMR structure and backbone dynamics of the major cold-shock protein (CspA) from Escherichia coli: evidence for conformational dynamics in the single-stranded RNA-binding site. Biochemistry. 1998 Aug 4;37(31):10881-96. doi: 10.1021/bi980269j. [Article]
  12. Schindelin H, Jiang W, Inouye M, Heinemann U: Crystal structure of CspA, the major cold shock protein of Escherichia coli. Proc Natl Acad Sci U S A. 1994 May 24;91(11):5119-23. doi: 10.1073/pnas.91.11.5119. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails