30S ribosomal protein S14
Details
- Name
- 30S ribosomal protein S14
- Synonyms
- Not Available
- Gene Name
- rpsN
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0017192|30S ribosomal protein S14 MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQ RNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
- Number of residues
- 101
- Molecular Weight
- 11580.36
- Theoretical pI
- 11.75
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosomeProcessestranslationComponentscytosolic small ribosomal subunit
- General Function
- Structural constituent of ribosome
- Specific Function
- Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.
- Pfam Domain Function
- Ribosomal_S14 (PF00253)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0017193|30S ribosomal protein S14 (rpsN) ATGGCTAAGCAATCAATGAAAGCACGCGAAGTAAAACGCGTAGCTTTAGCTGATAAATAC TTCGCGAAACGCGCTGAACTGAAAGCGATCATCTCTGATGTGAACGCTTCCGACGAAGAT CGTTGGAACGCTGTTCTCAAGCTGCAGACTCTGCCGCGTGATTCCAGCCCGTCTCGTCAG CGTAACCGCTGCCGTCAAACAGGTCGTCCGCATGGTTTCCTGCGGAAGTTCGGGTTGAGC CGTATTAAGGTCCGTGAAGCCGCTATGCGCGGTGAAATCCCGGGTCTGAAAAAGGCTAGC TGGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0AG59 UniProtKB Entry Name RS14_ECOLI GenBank Protein ID 809690 GenBank Gene ID X01563 - General References
- Cerretti DP, Dean D, Davis GR, Bedwell DM, Nomura M: The spc ribosomal protein operon of Escherichia coli: sequence and cotranscription of the ribosomal protein genes and a protein export gene. Nucleic Acids Res. 1983 May 11;11(9):2599-616. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00560 Tigecycline approved yes binder Details DB00759 Tetracycline approved, vet_approved yes inhibitor Details DB09093 Chlortetracycline approved, investigational, vet_approved yes inhibitor Details DB12615 Plazomicin approved, investigational unknown inhibitor Details DB12455 Omadacycline approved, investigational yes inhibitor Details