Single-stranded DNA-binding protein
Details
- Name
- Single-stranded DNA-binding protein
- Synonyms
- exrB
- Helix-destabilizing protein
- lexC
- SSB
- Gene Name
- ssb
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0011473|Single-stranded DNA-binding protein MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGG APAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF
- Number of residues
- 178
- Molecular Weight
- 18975.005
- Theoretical pI
- 5.24
- GO Classification
- Functionsenzyme activator activity / single-stranded DNA bindingProcessesDNA replication / mismatch repair / positive regulation of catalytic activity / recombinational repair / SOS responseComponentscytosol
- General Function
- Single-stranded dna binding
- Specific Function
- Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism. Acts as a sliding platform that migrates on DNA via reptation.
- Pfam Domain Function
- SSB (PF00436)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0011474|Single-stranded DNA-binding protein (ssb) ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAA GTACGCTACATGCCAAATGGTGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCC TGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTGAATGGCACCGCGTTGTGCTG TTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACA GAAGTCGTGGTGAACGTTGGCGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGC GCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGGGCGGTTGGGGTCAGCCTCAG CAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0AGE0 UniProtKB Entry Name SSB_ECOLI GenBank Protein ID 147870 GenBank Gene ID J01704 - General References
- Sancar A, Williams KR, Chase JW, Rupp WD: Sequences of the ssb gene and protein. Proc Natl Acad Sci U S A. 1981 Jul;78(7):4274-8. [Article]
- Chase JW, Merrill BM, Williams KR: F sex factor encodes a single-stranded DNA binding protein (SSB) with extensive sequence homology to Escherichia coli SSB. Proc Natl Acad Sci U S A. 1983 Sep;80(18):5480-4. [Article]
- Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL: Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Nucleic Acids Res. 1993 Nov 25;21(23):5408-17. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Beyreuther K, Berthold-Schmidt V, Geider K: Biological activity and a partial amino-acid sequence of Escherichia coli DNA-binding protein I isolated from overproducing cells. Eur J Biochem. 1982 Apr 1;123(2):415-20. [Article]
- Chase JW, L'Italien JJ, Murphy JB, Spicer EK, Williams KR: Characterization of the Escherichia coli SSB-113 mutant single-stranded DNA-binding protein. Cloning of the gene, DNA and protein sequence analysis, high pressure liquid chromatography peptide mapping, and DNA-binding studies. J Biol Chem. 1984 Jan 25;259(2):805-14. [Article]
- Williams KR, Murphy JB, Chase JW: Characterization of the structural and functional defect in the Escherichia coli single-stranded DNA binding protein encoded by the ssb-1 mutant gene. Expression of the ssb-1 gene under lambda pL regulation. J Biol Chem. 1984 Oct 10;259(19):11804-11. [Article]
- Casas-Finet JR, Khamis MI, Maki AH, Chase JW: Tryptophan 54 and phenylalanine 60 are involved synergistically in the binding of E. coli SSB protein to single-stranded polynucleotides. FEBS Lett. 1987 Aug 17;220(2):347-52. [Article]
- Meyer RR, Laine PS: The single-stranded DNA-binding protein of Escherichia coli. Microbiol Rev. 1990 Dec;54(4):342-80. [Article]
- Bujalowski W, Lohman TM: Monomers of the Escherichia coli SSB-1 mutant protein bind single-stranded DNA. J Mol Biol. 1991 Jan 5;217(1):63-74. [Article]
- Umezu K, Kolodner RD: Protein interactions in genetic recombination in Escherichia coli. Interactions involving RecO and RecR overcome the inhibition of RecA by single-stranded DNA-binding protein. J Biol Chem. 1994 Nov 25;269(47):30005-13. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Reddy M, Gowrishankar J: Identification and characterization of ssb and uup mutants with increased frequency of precise excision of transposon Tn10 derivatives: nucleotide sequence of uup in Escherichia coli. J Bacteriol. 1997 May;179(9):2892-9. [Article]
- Kelman Z, Yuzhakov A, Andjelkovic J, O'Donnell M: Devoted to the lagging strand-the subunit of DNA polymerase III holoenzyme contacts SSB to promote processive elongation and sliding clamp assembly. EMBO J. 1998 Apr 15;17(8):2436-49. [Article]
- Genschel J, Curth U, Urbanke C: Interaction of E. coli single-stranded DNA binding protein (SSB) with exonuclease I. The carboxy-terminus of SSB is the recognition site for the nuclease. Biol Chem. 2000 Mar;381(3):183-92. [Article]
- Cadman CJ, McGlynn P: PriA helicase and SSB interact physically and functionally. Nucleic Acids Res. 2004 Dec 2;32(21):6378-87. Print 2004. [Article]
- Mijakovic I, Petranovic D, Macek B, Cepo T, Mann M, Davies J, Jensen PR, Vujaklija D: Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine. Nucleic Acids Res. 2006 Mar 20;34(5):1588-96. Print 2006. [Article]
- Shereda RD, Bernstein DA, Keck JL: A central role for SSB in Escherichia coli RecQ DNA helicase function. J Biol Chem. 2007 Jun 29;282(26):19247-58. Epub 2007 May 3. [Article]
- Shereda RD, Kozlov AG, Lohman TM, Cox MM, Keck JL: SSB as an organizer/mobilizer of genome maintenance complexes. Crit Rev Biochem Mol Biol. 2008 Sep-Oct;43(5):289-318. doi: 10.1080/10409230802341296 . [Article]
- Lu D, Keck JL: Structural basis of Escherichia coli single-stranded DNA-binding protein stimulation of exonuclease I. Proc Natl Acad Sci U S A. 2008 Jul 8;105(27):9169-74. doi: 10.1073/pnas.0800741105. Epub 2008 Jun 30. [Article]
- Kozlov AG, Cox MM, Lohman TM: Regulation of single-stranded DNA binding by the C termini of Escherichia coli single-stranded DNA-binding (SSB) protein. J Biol Chem. 2010 May 28;285(22):17246-52. doi: 10.1074/jbc.M110.118273. Epub 2010 Apr 1. [Article]
- Lu D, Bernstein DA, Satyshur KA, Keck JL: Small-molecule tools for dissecting the roles of SSB/protein interactions in genome maintenance. Proc Natl Acad Sci U S A. 2010 Jan 12;107(2):633-8. doi: 10.1073/pnas.0909191107. Epub 2009 Dec 16. [Article]
- Zhou R, Kozlov AG, Roy R, Zhang J, Korolev S, Lohman TM, Ha T: SSB functions as a sliding platform that migrates on DNA via reptation. Cell. 2011 Jul 22;146(2):222-32. doi: 10.1016/j.cell.2011.06.036. [Article]
- Naue N, Beerbaum M, Bogutzki A, Schmieder P, Curth U: The helicase-binding domain of Escherichia coli DnaG primase interacts with the highly conserved C-terminal region of single-stranded DNA-binding protein. Nucleic Acids Res. 2013 Apr;41(8):4507-17. doi: 10.1093/nar/gkt107. Epub 2013 Feb 20. [Article]
- Huang YH, Lin MJ, Huang CY: Yeast two-hybrid analysis of PriB-interacting proteins in replication restart primosome: a proposed PriB-SSB interaction model. Protein J. 2013 Aug;32(6):477-83. doi: 10.1007/s10930-013-9509-y. [Article]
- Raghunathan S, Ricard CS, Lohman TM, Waksman G: Crystal structure of the homo-tetrameric DNA binding domain of Escherichia coli single-stranded DNA-binding protein determined by multiwavelength x-ray diffraction on the selenomethionyl protein at 2.9-A resolution. Proc Natl Acad Sci U S A. 1997 Jun 24;94(13):6652-7. [Article]
- Raghunathan S, Kozlov AG, Lohman TM, Waksman G: Structure of the DNA binding domain of E. coli SSB bound to ssDNA. Nat Struct Biol. 2000 Aug;7(8):648-52. [Article]