Cytochrome c2
Details
- Name
- Cytochrome c2
- Synonyms
- Cyt c2
- Gene Name
- cycA
- Organism
- Rhodobacter sphaeroides
- Amino acid sequence
>lcl|BSEQ0012900|Cytochrome c2 QEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPNLYGVVGRTAGTQADFKGYGEG MKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGKMTFKLKKEADAHNIWAYLQQV AVRP
- Number of residues
- 124
- Molecular Weight
- 13469.045
- Theoretical pI
- 7.5
- GO Classification
- Functionselectron carrier activity / heme binding / metal ion bindingProcessesoxidation-reduction process / photosynthesisComponentsperiplasmic space
- General Function
- Metal ion binding
- Specific Function
- Cytochrome c2 is found mainly in purple, non-sulfur, photosynthetic bacteria where it functions as the electron donor to the oxidized bacteriochlorophyll in the photophosphorylation pathway. However, it may also have a role in the respiratory chain and is found in some non-photosynthetic bacteria.
- Pfam Domain Function
- Cytochrom_C (PF00034)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0C0X8 UniProtKB Entry Name CYC2_RHOSH - General References
- Axelrod HL, Feher G, Allen JP, Chirino AJ, Day MW, Hsu BT, Rees DC: Crystallization and X-ray structure determination of cytochrome c2 from Rhodobacter sphaeroides in three crystal forms. Acta Crystallogr D Biol Crystallogr. 1994 Jul 1;50(Pt 4):596-602. [Article]
- Adir N, Axelrod HL, Beroza P, Isaacson RA, Rongey SH, Okamura MY, Feher G: Co-crystallization and characterization of the photosynthetic reaction center-cytochrome c2 complex from Rhodobacter sphaeroides. Biochemistry. 1996 Feb 27;35(8):2535-47. [Article]
- Gans P, Simorre JP, Caffrey M, Marion D, Richaud P, Vermeglio A: Sequential 1H and 15N NMR resonance assignment and secondary structure of ferrocytochrome c2 from Rhodobacter sphaeroides. J Biochem. 1996 Jun;119(6):1131-42. [Article]