C-C motif chemokine 3
Details
- Name
- C-C motif chemokine 3
- Synonyms
- G0/G1 switch regulatory protein 19-1
- G0S19-1
- Macrophage inflammatory protein 1-alpha
- MIP-1-alpha
- MIP1A
- PAT 464.1
- SCYA3
- SIS-beta
- Small-inducible cytokine A3
- Tonsillar lymphocyte LD78 alpha protein
- Gene Name
- CCL3
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0020617|C-C motif chemokine 3 MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Number of residues
- 92
- Molecular Weight
- 10085.355
- Theoretical pI
- 4.51
- GO Classification
- Functionscalcium-dependent protein kinase C activity / CCR1 chemokine receptor binding / CCR5 chemokine receptor binding / chemoattractant activity / chemokine activity / identical protein binding / kinase activity / phospholipase activator activity / protein kinase activityProcessesastrocyte cell migration / behavior / calcium ion transport / calcium-mediated signaling / cell activation / cell-cell signaling / cellular calcium ion homeostasis / cellular response to interferon-gamma / cellular response to interleukin-1 / cellular response to organic cyclic compound / cellular response to tumor necrosis factor / chemokine-mediated signaling pathway / chemotaxis / cytoskeleton organization / eosinophil chemotaxis / eosinophil degranulation / exocytosis / G-protein coupled receptor signaling pathway / granulocyte chemotaxis / inflammatory response / lipopolysaccharide-mediated signaling pathway / lymphocyte chemotaxis / macrophage chemotaxis / MAPK cascade / monocyte chemotaxis / negative regulation by host of viral transcription / negative regulation of bone mineralization / negative regulation of gene expression / negative regulation of osteoclast differentiation / neutrophil chemotaxis / osteoblast differentiation / positive chemotaxis / positive regulation of calcium ion import / positive regulation of calcium ion transport / positive regulation of calcium-mediated signaling / positive regulation of cell migration / positive regulation of ERK1 and ERK2 cascade / positive regulation of gene expression / positive regulation of GTPase activity / positive regulation of inflammatory response / positive regulation of interleukin-1 beta secretion / positive regulation of natural killer cell chemotaxis / positive regulation of neuron apoptotic process / positive regulation of protein kinase B signaling / positive regulation of tumor necrosis factor production / protein kinase B signaling / regulation of cell shape / regulation of sensory perception of pain / release of sequestered calcium ion into cytosol by sarcoplasmic reticulum / response to cholesterol / response to toxic substance / signaling / T cell chemotaxisComponentscytoplasm / cytosol / extracellular region / extracellular space / intracellular
- General Function
- Protein kinase activity
- Specific Function
- Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
- Pfam Domain Function
- IL8 (PF00048)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0020618|C-C motif chemokine 3 (CCL3) ATGCAGGTCTCCACTGCTGCCCTTGCTGTCCTCCTCTGCACCATGGCTCTCTGCAACCAG TTCTCTGCATCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGG CAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAGTGCTCCAAGCCC GGTGTCATCTTCCTAACCAAGCGAAGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGG GTCCAGAAATATGTCAGCGACCTGGAGCTGAGTGCCTGA
- Chromosome Location
- 17
- Locus
- 17q11-q21
- External Identifiers
Resource Link UniProtKB ID P10147 UniProtKB Entry Name CCL3_HUMAN GenBank Gene ID D00044 GenAtlas ID CCL3 HGNC ID HGNC:10627 - General References
- Obaru K, Fukuda M, Maeda S, Shimada K: A cDNA clone used to study mRNA inducible in human tonsillar lymphocytes by a tumor promoter. J Biochem. 1986 Mar;99(3):885-94. [Article]
- Zipfel PF, Balke J, Irving SG, Kelly K, Siebenlist U: Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors. J Immunol. 1989 Mar 1;142(5):1582-90. [Article]
- Blum S, Forsdyke RE, Forsdyke DR: Three human homologs of a murine gene encoding an inhibitor of stem cell proliferation. DNA Cell Biol. 1990 Oct;9(8):589-602. [Article]
- Nakao M, Nomiyama H, Shimada K: Structures of human genes coding for cytokine LD78 and their expression. Mol Cell Biol. 1990 Jul;10(7):3646-58. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Hunter MG, Bawden L, Brotherton D, Craig S, Cribbes S, Czaplewski LG, Dexter TM, Drummond AH, Gearing AH, Heyworth CM, Lord BI, McCourt M, Varley PG, Wood LM, Edwards RM, Lewis PJ: BB-10010: an active variant of human macrophage inflammatory protein-1 alpha with improved pharmaceutical properties. Blood. 1995 Dec 15;86(12):4400-8. [Article]
- Cocchi F, DeVico AL, Garzino-Demo A, Arya SK, Gallo RC, Lusso P: Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270(5243):1811-5. [Article]
- Bertini R, Luini W, Sozzani S, Bottazzi B, Ruggiero P, Boraschi D, Saggioro D, Chieco-Bianchi L, Proost P, van Damme J, et al.: Identification of MIP-1 alpha/LD78 as a monocyte chemoattractant released by the HTLV-I-transformed cell line MT4. AIDS Res Hum Retroviruses. 1995 Jan;11(1):155-60. [Article]
- Koopmann W, Krangel MS: Identification of a glycosaminoglycan-binding site in chemokine macrophage inflammatory protein-1alpha. J Biol Chem. 1997 Apr 11;272(15):10103-9. [Article]
- Guan E, Wang J, Roderiquez G, Norcross MA: Natural truncation of the chemokine MIP-1 beta /CCL4 affects receptor specificity but not anti-HIV-1 activity. J Biol Chem. 2002 Aug 30;277(35):32348-52. Epub 2002 Jun 17. [Article]
- Menten P, Wuyts A, Van Damme J: Macrophage inflammatory protein-1. Cytokine Growth Factor Rev. 2002 Dec;13(6):455-81. [Article]
- Czaplewski LG, McKeating J, Craven CJ, Higgins LD, Appay V, Brown A, Dudgeon T, Howard LA, Meyers T, Owen J, Palan SR, Tan P, Wilson G, Woods NR, Heyworth CM, Lord BI, Brotherton D, Christison R, Craig S, Cribbes S, Edwards RM, Evans SJ, Gilbert R, Morgan P, Randle E, Schofield N, Varley PG, Fisher J, Waltho JP, Hunter MG: Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants. J Biol Chem. 1999 Jun 4;274(23):16077-84. [Article]