Non-secretory ribonuclease

Details

Name
Non-secretory ribonuclease
Synonyms
  • 3.1.27.5
  • EDN
  • Eosinophil-derived neurotoxin
  • Ribonuclease 2
  • Ribonuclease US
  • RNase 2
  • RNase UpI-2
  • RNS2
Gene Name
RNASE2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0020520|Non-secretory ribonuclease
MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNY
QRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNI
SNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Number of residues
161
Molecular Weight
18354.09
Theoretical pI
8.83
GO Classification
Functions
endonuclease activity / nucleic acid binding / ribonuclease A activity / ribonuclease activity
Processes
chemotaxis / nucleic acid phosphodiester bond hydrolysis / positive regulation of protein targeting to mitochondrion / RNA catabolic process / RNA phosphodiester bond hydrolysis
Components
extracellular exosome / extracellular region / lysosome
General Function
Ribonuclease activity
Specific Function
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Lysosome
Gene sequence
>lcl|BSEQ0020521|Non-secretory ribonuclease (RNASE2)
ATGGTTCCAAAACTGTTCACTTCCCAAATTTGTCTGCTTCTTCTGTTGGGGCTTCTGGCT
GTGGAGGGCTCACTCCATGTCAAACCTCCACAGTTTACCTGGGCTCAATGGTTTGAAACC
CAGCACATCAATATGACCTCCCAGCAATGCACCAATGCAATGCAGGTCATTAACAATTAT
CAACGGCGATGCAAAAACCAAAATACTTTCCTTCTTACAACTTTTGCTAACGTAGTTAAT
GTTTGTGGTAACCCAAATATGACCTGTCCTAGTAACAAAACTCGCAAAAATTGTCACCAC
AGTGGAAGCCAGGTGCCTTTAATCCACTGTAACCTCACAACTCCAAGTCCACAGAATATT
TCAAACTGCAGGTATGCGCAGACACCAGCAAACATGTTCTATATAGTTGCATGTGACAAC
AGAGATCAACGACGAGACCCTCCACAGTATCCGGTGGTTCCAGTTCACCTGGATAGAATC
ATCTAA
Chromosome Location
14
Locus
14q24-q31
External Identifiers
ResourceLink
UniProtKB IDP10153
UniProtKB Entry NameRNAS2_HUMAN
GenBank Protein ID181955
GenBank Gene IDM30510
GenAtlas IDRNASE2
HGNC IDHGNC:10045
General References
  1. Hamann KJ, Barker RL, Loegering DA, Pease LR, Gleich GJ: Sequence of human eosinophil-derived neurotoxin cDNA: identity of deduced amino acid sequence with human nonsecretory ribonucleases. Gene. 1989 Nov 15;83(1):161-7. [Article]
  2. Barker RL, Loegering DA, Ten RM, Hamann KJ, Pease LR, Gleich GJ: Eosinophil cationic protein cDNA. Comparison with other toxic cationic proteins and ribonucleases. J Immunol. 1989 Aug 1;143(3):952-5. [Article]
  3. Rosenberg HF, Tenen DG, Ackerman SJ: Molecular cloning of the human eosinophil-derived neurotoxin: a member of the ribonuclease gene family. Proc Natl Acad Sci U S A. 1989 Jun;86(12):4460-4. [Article]
  4. Hamann KJ, Ten RM, Loegering DA, Jenkins RB, Heise MT, Schad CR, Pease LR, Gleich GJ, Barker RL: Structure and chromosome localization of the human eosinophil-derived neurotoxin and eosinophil cationic protein genes: evidence for intronless coding sequences in the ribonuclease gene superfamily. Genomics. 1990 Aug;7(4):535-46. [Article]
  5. Zhang J, Rosenberg HF: Sequence variation at two eosinophil-associated ribonuclease loci in humans. Genetics. 2000 Dec;156(4):1949-58. [Article]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  7. Beintema JJ, Hofsteenge J, Iwama M, Morita T, Ohgi K, Irie M, Sugiyama RH, Schieven GL, Dekker CA, Glitz DG: Amino acid sequence of the nonsecretory ribonuclease of human urine. Biochemistry. 1988 Jun 14;27(12):4530-8. [Article]
  8. Gleich GJ, Loegering DA, Bell MP, Checkel JL, Ackerman SJ, McKean DJ: Biochemical and functional similarities between human eosinophil-derived neurotoxin and eosinophil cationic protein: homology with ribonuclease. Proc Natl Acad Sci U S A. 1986 May;83(10):3146-50. [Article]
  9. Niwata Y, Ohgi K, Sanda A, Takizawa Y, Irie M: Purification and properties of bovine kidney ribonucleases. J Biochem. 1985 Mar;97(3):923-34. [Article]
  10. Sorrentino S, Tucker GK, Glitz DG: Purification and characterization of a ribonuclease from human liver. J Biol Chem. 1988 Nov 5;263(31):16125-31. [Article]
  11. Sakakibara R, Hashida K, Kitahara T, Ishiguro M: Characterization of a unique nonsecretory ribonuclease from urine of pregnant women. J Biochem. 1992 Mar;111(3):325-30. [Article]
  12. Kardana A, Bagshawe KD, Coles B, Read D, Taylor M: Characterisation of UGP and its relationship with beta-core fragment. Br J Cancer. 1993 Apr;67(4):686-92. [Article]
  13. Hofsteenge J, Muller DR, de Beer T, Loffler A, Richter WJ, Vliegenthart JF: New type of linkage between a carbohydrate and a protein: C-glycosylation of a specific tryptophan residue in human RNase Us. Biochemistry. 1994 Nov 22;33(46):13524-30. [Article]
  14. de Beer T, Vliegenthart JF, Loffler A, Hofsteenge J: The hexopyranosyl residue that is C-glycosidically linked to the side chain of tryptophan-7 in human RNase Us is alpha-mannopyranose. Biochemistry. 1995 Sep 19;34(37):11785-9. [Article]
  15. Krieg J, Hartmann S, Vicentini A, Glasner W, Hess D, Hofsteenge J: Recognition signal for C-mannosylation of Trp-7 in RNase 2 consists of sequence Trp-x-x-Trp. Mol Biol Cell. 1998 Feb;9(2):301-9. [Article]
  16. Teufel DP, Kao RY, Acharya KR, Shapiro R: Mutational analysis of the complex of human RNase inhibitor and human eosinophil-derived neurotoxin (RNase 2). Biochemistry. 2003 Feb 18;42(6):1451-9. [Article]
  17. Yang D, Rosenberg HF, Chen Q, Dyer KD, Kurosaka K, Oppenheim JJ: Eosinophil-derived neurotoxin (EDN), an antimicrobial protein with chemotactic activities for dendritic cells. Blood. 2003 Nov 1;102(9):3396-403. Epub 2003 Jul 10. [Article]
  18. Ulrich M, Petre A, Youhnovski N, Promm F, Schirle M, Schumm M, Pero RS, Doyle A, Checkel J, Kita H, Thiyagarajan N, Acharya KR, Schmid-Grendelmeier P, Simon HU, Schwarz H, Tsutsui M, Shimokawa H, Bellon G, Lee JJ, Przybylski M, Doring G: Post-translational tyrosine nitration of eosinophil granule toxins mediated by eosinophil peroxidase. J Biol Chem. 2008 Oct 17;283(42):28629-40. doi: 10.1074/jbc.M801196200. Epub 2008 Aug 11. [Article]
  19. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  20. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
  21. Mosimann SC, Newton DL, Youle RJ, James MN: X-ray crystallographic structure of recombinant eosinophil-derived neurotoxin at 1.83 A resolution. J Mol Biol. 1996 Jul 26;260(4):540-52. [Article]
  22. Leonidas DD, Boix E, Prill R, Suzuki M, Turton R, Minson K, Swaminathan GJ, Youle RJ, Acharya KR: Mapping the ribonucleolytic active site of eosinophil-derived neurotoxin (EDN). High resolution crystal structures of EDN complexes with adenylic nucleotide inhibitors. J Biol Chem. 2001 May 4;276(18):15009-17. Epub 2001 Jan 11. [Article]
  23. Iyer S, Holloway DE, Kumar K, Shapiro R, Acharya KR: Molecular recognition of human eosinophil-derived neurotoxin (RNase 2) by placental ribonuclease inhibitor. J Mol Biol. 2005 Apr 1;347(3):637-55. [Article]
  24. Baker MD, Holloway DE, Swaminathan GJ, Acharya KR: Crystal structures of eosinophil-derived neurotoxin (EDN) in complex with the inhibitors 5'-ATP, Ap3A, Ap4A, and Ap5A. Biochemistry. 2006 Jan 17;45(2):416-26. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01812Adenosine 3',5'-diphosphateexperimentalunknownDetails
DB02098Adenosine-2'-5'-DiphosphateexperimentalunknownDetails