Cytochrome c oxidase subunit 8A, mitochondrial

Details

Name
Cytochrome c oxidase subunit 8A, mitochondrial
Synonyms
  • COX8
  • COX8L
  • Cytochrome c oxidase polypeptide VIII-liver/heart
  • Cytochrome c oxidase subunit 8-2
Gene Name
COX8A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012781|Cytochrome c oxidase subunit 8A, mitochondrial
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE
Number of residues
69
Molecular Weight
7579.0
Theoretical pI
10.83
GO Classification
Functions
cytochrome-c oxidase activity
Processes
cellular metabolic process / gene expression / generation of precursor metabolites and energy / hydrogen ion transmembrane transport / mitochondrial electron transport, cytochrome c to oxygen / mitophagy in response to mitochondrial depolarization / positive regulation of defense response to virus by host / respiratory electron transport chain / small molecule metabolic process / transcription initiation from RNA polymerase II promoter / xenophagy
Components
integral component of membrane / mitochondrial inner membrane / mitochondrial respiratory chain complex IV
General Function
Cytochrome-c oxidase activity
Specific Function
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane Regions
37-60
Cellular Location
Mitochondrion inner membrane
Gene sequence
>lcl|BSEQ0012782|Cytochrome c oxidase subunit 8A, mitochondrial (COX8A)
ATGTCCGTCCTGACGCCGCTGCTGCTGCGGGGCTTGACAGGCTCGGCCCGGCGGCTCCCA
GTGCCGCGCGCCAAGATCCATTCGTTGCCGCCGGAGGGGAAGCTTGGGATCATGGAATTG
GCCGTTGGGCTTACCTCCTGCTTCGTGACCTTCCTCCTGCCAGCGGGCTGGATCCTGTCA
CACCTGGAGACCTACAGGAGGCCAGAGTGA
Chromosome Location
11
Locus
11q12-q13
External Identifiers
ResourceLink
UniProtKB IDP10176
UniProtKB Entry NameCOX8A_HUMAN
GenBank Protein ID38614453
GenBank Gene IDBC063025
HGNC IDHGNC:2294
General References
  1. Rizzuto R, Nakase H, Darras B, Francke U, Fabrizi GM, Mengel T, Walsh F, Kadenbach B, DiMauro S, Schon EA: A gene specifying subunit VIII of human cytochrome c oxidase is localized to chromosome 11 and is expressed in both muscle and non-muscle tissues. J Biol Chem. 1989 Jun 25;264(18):10595-600. [Article]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  3. Van Kuilenburg AB, Muijsers AO, Demol H, Dekker HL, Van Beeumen JJ: Human heart cytochrome c oxidase subunit VIII. Purification and determination of the complete amino acid sequence. FEBS Lett. 1988 Nov 21;240(1-2):127-32. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02659Cholic AcidapprovedunknownDetails
DB04464N-FormylmethionineexperimentalunknownDetails