Microtubule-associated protein 2

Details

Name
Microtubule-associated protein 2
Synonyms
  • MAP-2
Gene Name
MAP2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037123|Microtubule-associated protein 2
MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGE
HGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT
AALPLAAEETANLPPSPPPSPASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEK
ESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTEEEKAPLALFGHTLVASLEDMKQK
TEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGLVAPISPGPLTPMREKDVFDD
IPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDKKSLQQTSGPA
TAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV
QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHT
FSEQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMR
VDDKDKIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRE
SVHESIDTMSPMHKNGDKEFQTGKESQPSPPAQEAGYSTLAQSYPSDLPEEPSSPQERMF
TIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGR
GHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIEKVKATGEEST
QAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV
EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGT
DDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRL
DTVLEKSEEHADSKEHAKKTEEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLS
SVPEIAEVEPSKKVEQGLDFAVQGQLDVKISDFGQMASGLNIDDRRATELKLEATQDMTP
SSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESL
TMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVE
RRPSPHDEEEFEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDD
SIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRIST
PERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
CVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDE
NSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTP
SYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST
DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKV
GSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSS
GSINLLESPQLATLAEDVTAALAKQGL
Number of residues
1827
Molecular Weight
199524.51
Theoretical pI
4.55
GO Classification
Functions
dystroglycan binding / microtubule binding / structural molecule activity
Processes
axonogenesis / cellular response to organic substance / central nervous system neuron development / dendrite morphogenesis / microtubule bundle formation / microtubule cytoskeleton organization / neuron projection development / response to estradiol / response to progesterone
Components
CA3 pyramidal cell dendrite / cytoplasm / dendritic shaft / microtubule / microtubule associated complex / neuron projection / neuronal cell body / neuronal postsynaptic density / nuclear periphery / nucleolus / rough endoplasmic reticulum / smooth endoplasmic reticulum
General Function
Structural molecule activity
Specific Function
The exact function of MAP2 is unknown but MAPs may stabilize the microtubules against depolymerization. They also seem to have a stiffening effect on microtubules.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010771|Microtubule-associated protein 2 (MAP2)
ATGGCAGATGAACGGAAAGATGAAGCAAAGGCACCTCACTGGACCTCAGCACCGCTAACA
GAGGCATCTGCACACTCACATCCACCTGAGATTAAGGATCAAGGCGGAGCAGGGGAAGGA
CTTGTCCGAAGCGCCAATGGATTCCCATACAGGGAGGATGAAGAGGGTGCCTTTGGAGAG
CATGGGTCACAGGGCACCTATTCAAATACCAAAGAGAATGGGATCAACGGAGAGCTGACC
TCAGCTGACAGAGAAACAGCAGAGGAGGTGTCTGCAAGGATAGTTCAAGTAGTCACTGCT
GAGGCTGTAGCAGTCCTGAAAGGTGAACAAGAGAAAGAAGCTCAACATAAAGACCAGACT
GCAGCTCTGCCTTTAGCAGCTGAAGAAACAGCTAATCTGCCTCCTTCTCCACCCCCATCA
CCTGCCTCAGAACAGACTGTCACAGTGGAGGAAGCAGCAGGTGGGGAATCAGCTCTGGCT
CCCAGTGTATTTAAACAGGCAAAGGACAAAGTCTCTAATTCTACCTTGTCAAAGATTCCT
GCTTTACAGGGTAGCACAAAGTCCCCAAGATACAGCTCAGCCTGCCCTAGCACGACTAAA
AGGGCTACATTTTCTGACAGTTTATTAATACAGCCCACCTCAGCAGGCTCCACAGACCGT
TTGCCATACTCAAAATCAGGGAACAAGGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCT
TCTCTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGAT
GAGAATTCCTTCTCTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCA
GAGCCAATTCGCAGAGCAGGGAAGAGTGGTACCTCAACACCCACTACCCCTGGGTCTACT
GCCATCACTCCTGGCACCCCACCAAGTTATTCTTCACGCACACCAGGCACTCCTGGAACC
CCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGTCTGCCATCTTGGTGCCG
AGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCAAAATCTCCTGCGACTCCCAAGCAG
CTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCA
ACAGACAACATCAAATACCAGCCTAAAGGGGGGCAGGTTAGGATTTTAAACAAGAAGATC
GATTTTAGCAAAGTTCAGTCCAGATGTGGTTCCAAGGATAACATCAAACATTCGGCTGGG
GGCGGAAATGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATGTGACATCCAAATGT
GGCTCTCTGAAGAACATCCGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAGTGTA
AAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCAT
GTACCTGGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCT
AAAGCCCGTGTGGACCATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTG
GCATCACCCCGACGACTCAGCAATGTCTCCTCGTCTGGAAGCATCAACCTGCTCGAATCT
CCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCTGCACTCGCTAAGCAGGGCTTGTGA
Chromosome Location
2
Locus
2q34-q35
External Identifiers
ResourceLink
UniProtKB IDP11137
UniProtKB Entry NameMTAP2_HUMAN
GenBank Protein ID409875
GenBank Gene IDU01828
GenAtlas IDMAP2
HGNC IDHGNC:6839
General References
  1. Albala JS, Kalcheva N, Shafit-Zagardo B: Characterization of the transcripts encoding two isoforms of human microtubule-associated protein-2 (MAP-2). Gene. 1993 Dec 22;136(1-2):377-8. [PubMed:8294038]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Dammerman M, Yen SH, Shafit-Zagardo B: Sequence of a human MAP-2 region sharing epitopes with Alzheimer neurofibrillary tangles. J Neurosci Res. 1989 Dec;24(4):487-95. [PubMed:2481044]
  5. Kosik KS, Orecchio LD, Bakalis S, Duffy L, Neve RL: Partial sequence of MAP2 in the region of a shared epitope with Alzheimer neurofibrillary tangles. J Neurochem. 1988 Aug;51(2):587-98. [PubMed:2455776]
  6. Zamora-Leon SP, Bresnick A, Backer JM, Shafit-Zagardo B: Fyn phosphorylates human MAP-2c on tyrosine 67. J Biol Chem. 2005 Jan 21;280(3):1962-70. Epub 2004 Nov 9. [PubMed:15536091]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336]
  9. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  10. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  11. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01196Estramustineapproved, investigationalyesantagonistDetails
DB01229Paclitaxelapproved, vet_approvedyesDetails
DB01248Docetaxelapproved, investigationalyesDetails