Steroid hormone receptor ERR1
Details
- Name
- Steroid hormone receptor ERR1
- Synonyms
- ERR-alpha
- ERR1
- ESRL1
- Estrogen receptor-like 1
- Estrogen-related receptor alpha
- NR3B1
- Nuclear receptor subfamily 3 group B member 1
- Gene Name
- ESRRA
- UniProtKB Entry
- P11474Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0007149|Steroid hormone receptor ERR1 MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA MMD
- Number of residues
- 423
- Molecular Weight
- 45509.11
- Theoretical pI
- 6.33
- GO Classification
- FunctionsDNA-binding transcription factor activity / DNA-binding transcription factor activity, RNA polymerase II-specific / estrogen response element binding / nuclear receptor activity / nuclear steroid receptor activity / sequence-specific double-stranded DNA bindingProcessesintracellular steroid hormone receptor signaling pathway / positive regulation of transcription by RNA polymerase II / regulation of DNA-templated transcription / regulation of transcription by RNA polymerase IIComponentschromatin / cytoplasm / fibrillar center
- General Function
- Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. Binds to the C1 region of the lactoferrin gene promoter. Requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism. Induces the expression of PERM1 in the skeletal muscle
- Specific Function
- Dna-binding transcription factor activity
- Pfam Domain Function
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
>lcl|BSEQ0012595|Steroid hormone receptor ERR1 (ESRRA) ATGTCCAGCCAGGTGGTGGGCATTGAGCCTCTCTACATCAAGGCAGAGCCGGCCAGCCCT GACAGTCCAAAGGGTTCCTCGGAGACAGAGACCGAGCCTCCTGTGGCCCTGGCCCCTGGT CCAGCTCCCACTCGCTGCCTCCCAGGCCACAAGGAAGAGGAGGATGGGGAGGGGGCTGGG CCTGGCGAGCAGGGCGGTGGGAAGCTGGTGCTCAGCTCCCTGCCCAAGCGCCTCTGCCTG GTCTGTGGGGACGTGGCCTCCGGCTACCACTATGGTGTGGCATCCTGTGAGGCCTGCAAA GCCTTCTTCAAGAGGACCATCCAGGGGAGCATCGAGTACAGCTGTCCGGCCTCCAACGAG TGTGAGATCACCAAGCGGAGACGCAAGGCCTGCCAGGCCTGCCGCTTCACCAAGTGCCTG CGGGTGGGCATGCTCAAGGAGGGAGTGCGCCTGGACCGCGTCCGGGGTGGGCGGCAGAAG TACAAGCGGCGGCCGGAGGTGGACCCACTGCCCTTCCCGGGCCCCTTCCCTGCTGGGCCC CTGGCAGTCGCTGGAGGCCCCCGGAAGACAGCAGCCCCAGTGAATGCACTGGTGTCTCAT CTGCTGGTGGTTGAGCCTGAGAAGCTCTATGCCATGCCTGACCCCGCAGGCCCTGATGGG CACCTCCCAGCCGTGGCTACCCTCTGTGACCTCTTTGACCGAGAGATTGTGGTCACCATC AGCTGGGCCAAGAGCATCCCAGGCTTCTCATCGCTGTCGCTGTCTGACCAGATGTCAGTA CTGCAGAGCGTGTGGATGGAGGTGCTGGTGCTGGGTGTGGCCCAGCGCTCACTGCCACTG CAGGATGAGCTGGCCTTCGCTGAGGACTTAGTCCTGGATGAAGAGGGGGCACGGGCAGCT GGCCTGGGGGAACTGGGGGCTGCCCTGCTGCAACTAGTGCGGCGGCTGCAGGCCCTGCGG CTGGAGCGAGAGGAGTATGTTCTACTAAAGGCCTTGGCCCTTGCCAATTCAGACTCTGTG CACATCGAAGATGCCGAGGCTGTGGAGCAGCTGCGAGAAGCTCTGCACGAGGCCCTGCTG GAGTATGAAGCCGGCCGGGCTGGCCCCGGAGGGGGTGCTGAGCGGCGGCGGGCGGGCAGG CTGCTGCTCACGCTACCGCTCCTCCGCCAGACAGCGGGCAAAGTGCTGGCCCATTTCTAT GGGGTGAAGCTGGAGGGCAAGGTGCCCATGCACAAGCTGTTCTTGGAGATGCTCGAGGCC ATGATGGACTGA
- Chromosome Location
- 11
- Locus
- 11q13.1
- External Identifiers
Resource Link UniProtKB ID P11474 UniProtKB Entry Name ERR1_HUMAN GenBank Protein ID 36609 GenBank Gene ID X51416 GeneCard ID ESRRA HGNC ID HGNC:3471 PDB ID(s) 1XB7, 2PJL, 3D24, 3K6P, 7E2E KEGG ID hsa:2101 IUPHAR/Guide To Pharmacology ID 622 NCBI Gene ID 2101 - General References
- Giguere V, Yang N, Segui P, Evans RM: Identification of a new class of steroid hormone receptors. Nature. 1988 Jan 7;331(6151):91-4. [Article]
- Yang N, Shigeta H, Shi H, Teng CT: Estrogen-related receptor, hERR1, modulates estrogen receptor-mediated response of human lactoferrin gene promoter. J Biol Chem. 1996 Mar 8;271(10):5795-804. [Article]
- Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
- Wiley SR, Kraus RJ, Zuo F, Murray EE, Loritz K, Mertz JE: SV40 early-to-late switch involves titration of cellular transcriptional repressors. Genes Dev. 1993 Nov;7(11):2206-19. [Article]
- Sladek R, Bader JA, Giguere V: The orphan nuclear receptor estrogen-related receptor alpha is a transcriptional regulator of the human medium-chain acyl coenzyme A dehydrogenase gene. Mol Cell Biol. 1997 Sep;17(9):5400-9. [Article]
- Schreiber SN, Knutti D, Brogli K, Uhlmann T, Kralli A: The transcriptional coactivator PGC-1 regulates the expression and activity of the orphan nuclear receptor estrogen-related receptor alpha (ERRalpha). J Biol Chem. 2003 Mar 14;278(11):9013-8. Epub 2003 Jan 8. [Article]
- Barry JB, Laganiere J, Giguere V: A single nucleotide in an estrogen-related receptor alpha site can dictate mode of binding and peroxisome proliferator-activated receptor gamma coactivator 1alpha activation of target promoters. Mol Endocrinol. 2006 Feb;20(2):302-10. Epub 2005 Sep 8. [Article]
- Vu EH, Kraus RJ, Mertz JE: Phosphorylation-dependent sumoylation of estrogen-related receptor alpha1. Biochemistry. 2007 Aug 28;46(34):9795-804. Epub 2007 Aug 4. [Article]
- Tremblay AM, Wilson BJ, Yang XJ, Giguere V: Phosphorylation-dependent sumoylation regulates estrogen-related receptor-alpha and -gamma transcriptional activity through a synergy control motif. Mol Endocrinol. 2008 Mar;22(3):570-84. Epub 2007 Dec 6. [Article]
- Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [Article]
- Wilson BJ, Tremblay AM, Deblois G, Sylvain-Drolet G, Giguere V: An acetylation switch modulates the transcriptional activity of estrogen-related receptor alpha. Mol Endocrinol. 2010 Jul;24(7):1349-58. doi: 10.1210/me.2009-0441. Epub 2010 May 19. [Article]
- Cho Y, Hazen BC, Russell AP, Kralli A: Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells. J Biol Chem. 2013 Aug 30;288(35):25207-18. doi: 10.1074/jbc.M113.489674. Epub 2013 Jul 8. [Article]
- Kallen J, Schlaeppi JM, Bitsch F, Filipuzzi I, Schilb A, Riou V, Graham A, Strauss A, Geiser M, Fournier B: Evidence for ligand-independent transcriptional activation of the human estrogen-related receptor alpha (ERRalpha): crystal structure of ERRalpha ligand binding domain in complex with peroxisome proliferator-activated receptor coactivator-1alpha. J Biol Chem. 2004 Nov 19;279(47):49330-7. Epub 2004 Aug 26. [Article]
- Greschik H, Althage M, Flaig R, Sato Y, Chavant V, Peluso-Iltis C, Choulier L, Cronet P, Rochel N, Schule R, Stromstedt PE, Moras D: Communication between the ERRalpha homodimer interface and the PGC-1alpha binding surface via the helix 8-9 loop. J Biol Chem. 2008 Jul 18;283(29):20220-30. doi: 10.1074/jbc.M801920200. Epub 2008 Apr 25. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Steroid hormone receptor ERR1 (Humans) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Troglitazone approved, investigational, withdrawn no target inverse agonist Details 1-CYCLOHEXYL-N-{[1-(4-METHYLPHENYL)-1H-INDOL-3-YL]METHYL}METHANAMINE experimental yes target antagonist Details beta-Naphthoflavone experimental unknown target Details Diethylstilbestrol approved, investigational, withdrawn unknown target Details Flavone approved, experimental unknown target agonist Details Genistein investigational unknown target agonist Details Afimoxifene investigational unknown target inhibitor Details Daidzein experimental yes target agonist Details Biochanin A investigational yes target agonist Details Dexamethasone palmitate investigational yes target agonist Details Pregnenolone approved, experimental yes target agonist Details Rimexolone approved yes target modulator Details Ulobetasol approved yes target modulator Details Desonide approved, investigational yes target modulator Details Fluocinonide approved, investigational yes target modulator Details Medrysone approved yes target modulator Details Halcinonide approved, investigational, withdrawn yes target modulator Details Amcinonide approved yes target modulator Details Prednicarbate approved, investigational yes target modulator Details Desoximetasone approved yes target modulator Details Flumethasone approved, vet_approved yes target modulator Details Auranofin approved, investigational yes target modulator Details Cortisone acetate approved, investigational yes target modulator Details Loteprednol etabonate approved yes target modulator Details Flurandrenolide approved yes target modulator Details