6,7-dimethyl-8-ribityllumazine synthase
Details
- Name
- 6,7-dimethyl-8-ribityllumazine synthase
- Synonyms
- 2.5.1.78
- DMRL synthase
- Heavy riboflavin synthase beta subunit
- HRS beta subunit
- Gene Name
- ribH
- Organism
- Bacillus subtilis (strain 168)
- Amino acid sequence
>lcl|BSEQ0019174|6,7-dimethyl-8-ribityllumazine synthase MNIIQGNLVGTGLKIGIVVGRFNDFITSKLLSGAEDALLRHGVDTNDIDVAWVPGAFEIP FAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTEN IEQAIERAGTKAGNKGVDCAVSAIEMANLNRSFE
- Number of residues
- 154
- Molecular Weight
- 16286.485
- Theoretical pI
- 5.19
- GO Classification
- Functions6,7-dimethyl-8-ribityllumazine synthase activity / transferase activityProcessesriboflavin biosynthetic processComponentsriboflavin synthase complex
- General Function
- Transferase activity
- Specific Function
- Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin. Is able to use the non-natural R enantiomer of 3,4-dihydroxy-2-butanone 4-phosphate as a substrate, but with less efficiency than the natural S enantiomer. Cannot use unphosphorylated 3,4-dihydroxy-2-butanone, 3,4-dihydroxy-2-butanone 3-phosphate or diacetyl as substrates.
- Pfam Domain Function
- DMRL_synthase (PF00885)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0019175|6,7-dimethyl-8-ribityllumazine synthase (ribH) ATGAATATCATACAAGGAAATTTAGTTGGTACAGGTCTTAAAATCGGAATCGTAGTAGGA AGATTTAATGATTTTATTACGAGCAAGCTGCTGAGCGGAGCAGAAGATGCGCTGCTCAGA CATGGCGTAGACACAAATGACATTGATGTGGCTTGGGTTCCAGGCGCATTTGAAATACCG TTTGCTGCGAAAAAAATGGCGGAAACAAAAAAATATGATGCTATTATCACATTGGGCACT GTCATCAGAGGCGCAACGACACATTACGATTATGTCTGCAATGAAGCTGCAAAAGGCATC GCGCAAGCAGCAAACACTACTGGTGTACCTGTCATCTTTGGAATTGTAACAACTGAAAAC ATCGAACAGGCTATCGAGCGTGCCGGCACAAAAGCGGGCAACAAAGGTGTAGATTGTGCT GTTTCTGCCATTGAAATGGCAAATTTAAACCGCTCATTTGAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P11998 UniProtKB Entry Name RISB_BACSU GenBank Protein ID 410128 GenBank Gene ID L09228 - General References
- Ludwig HC, Lottspeich F, Henschen A, Ladenstein R, Bacher A: Heavy riboflavin synthase of Bacillus subtilis. Primary structure of the beta subunit. J Biol Chem. 1987 Jan 25;262(3):1016-21. [Article]
- Sorokin A, Zumstein E, Azevedo V, Ehrlich SD, Serror P: The organization of the Bacillus subtilis 168 chromosome region between the spoVA and serA genetic loci, based on sequence data. Mol Microbiol. 1993 Oct;10(2):385-95. [Article]
- Fischer M, Haase I, Kis K, Meining W, Ladenstein R, Cushman M, Schramek N, Huber R, Bacher A: Enzyme catalysis via control of activation entropy: site-directed mutagenesis of 6,7-dimethyl-8-ribityllumazine synthase. J Mol Biol. 2003 Feb 21;326(3):783-93. [Article]
- Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
- Graumann P, Schroder K, Schmid R, Marahiel MA: Cold shock stress-induced proteins in Bacillus subtilis. J Bacteriol. 1996 Aug;178(15):4611-9. [Article]
- Bacher A, Ludwig HC, Schnepple H, Ben-Shaul Y: Heavy riboflavin synthase from Bacillus subtilis. Quaternary structure and reaggregation. J Mol Biol. 1986 Jan 5;187(1):75-86. [Article]
- Kis K, Volk R, Bacher A: Biosynthesis of riboflavin. Studies on the reaction mechanism of 6,7-dimethyl-8-ribityllumazine synthase. Biochemistry. 1995 Mar 7;34(9):2883-92. [Article]
- Ladenstein R, Schneider M, Huber R, Bartunik HD, Wilson K, Schott K, Bacher A: Heavy riboflavin synthase from Bacillus subtilis. Crystal structure analysis of the icosahedral beta 60 capsid at 3.3 A resolution. J Mol Biol. 1988 Oct 20;203(4):1045-70. [Article]
- Ritsert K, Huber R, Turk D, Ladenstein R, Schmidt-Base K, Bacher A: Studies on the lumazine synthase/riboflavin synthase complex of Bacillus subtilis: crystal structure analysis of reconstituted, icosahedral beta-subunit capsids with bound substrate analogue inhibitor at 2.4 A resolution. J Mol Biol. 1995 Oct 13;253(1):151-67. [Article]