Metallothionein-1G
Details
- Name
- Metallothionein-1G
- Synonyms
- Metallothionein-1K
- Metallothionein-IG
- MT-1G
- MT-1K
- MT-IG
- MT1K
- MT1M
- Gene Name
- MT1G
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0049463|Metallothionein-1G MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC CA
- Number of residues
- 62
- Molecular Weight
- 6141.225
- Theoretical pI
- Not Available
- GO Classification
- Functionszinc ion bindingProcessescellular response to cadmium ion / cellular response to copper ion / cellular response to vascular endothelial growth factor stimulus / cellular response to zinc ion / monocyte activation / monocyte differentiation / negative regulation of growthComponentscytoplasm / nucleus / perinuclear region of cytoplasm
- General Function
- Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
- Specific Function
- Zinc ion binding
- Pfam Domain Function
- Metallothio (PF00131)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0049464|Metallothionein-1G (MT1G) ATGGACCCCAACTGCTCCTGTGCCGCTGCAGGTGTCTCCTGCACCTGCGCCAGCTCCTGC AAGTGCAAAGAGTGCAAATGCACCTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCTGTG GGCTGTGCCAAGTGTGCCCAGGGCTGCATCTGCAAAGGGGCATCGGAGAAGTGCAGCTGC TGCGCCTGA
- Chromosome Location
- 16
- Locus
- 16q13
- External Identifiers
Resource Link UniProtKB ID P13640 UniProtKB Entry Name MT1G_HUMAN HGNC ID HGNC:7399 - General References
- Foster R, Jahroudi N, Varshney U, Gedamu L: Structure and expression of the human metallothionein-IG gene. Differential promoter activity of two linked metallothionein-I genes in response to heavy metals. J Biol Chem. 1988 Aug 15;263(23):11528-35. [Article]
- Gedamu L, Varshney U, Jahroudi N, Foster R, Shworak NW: Structure and expression of the human metallothionein genes. Experientia Suppl. 1987;52:361-72. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Pauwels M, van Weyenbergh J, Soumillion A, Proost P, De Ley M: Induction by zinc of specific metallothionein isoforms in human monocytes. Eur J Biochem. 1994 Feb 15;220(1):105-10. [Article]