Cytochrome P450 2A2

Details

Name
Cytochrome P450 2A2
Synonyms
  • 1.14.14.1
  • Cyp2a-2
  • CYPIIA2
  • Cytochrome P450-UT-4
  • Testosterone 15-alpha-hydroxylase
Gene Name
Cyp2a2
Organism
Rat
Amino acid sequence
>lcl|BSEQ0013304|Cytochrome P450 2A2
MLDTGLLLVVILASLSVMFLVSLWQQKIRERLPPGPTPLPFIGNYLQLNMKDVYSSITQL
SERYGPVFTIHLGPRRIVVLYGYDAVKEALVDQAEEFSGRGELPTFNILFKGYGFSLSNV
EQAKRIRRFTIATLRDFGVGKRDVQECILEEAGYLIKTLQGTCGAPIDPSIYLSKTVSNV
INSIVFGNRFDYEDKEFLSLLEMIDEMNIFAASATGQLYDMFHSVMKYLPGPQQQIIKVT
QKLEDFMIEKVRQNHSTLDPNSPRNFIDSFLIRMQEEKYVNSEFHMNNLVMSSLGLLFAG
TGSVSSTLYHGFLLLMKHPDVEAKVHEEIERVIGRNRQPQYEDHMKMPYTQAVINEIQRF
SNLAPLGIPRRIIKNTTFRGFFLPKGTDVFPIIGSLMTEPKFFPNHKDFNPQHFLDDKGQ
LKKNAAFLPFSIGKRFCLGDSLAKMELFLLLTTILQNFRFKFPMNLEDINEYPSPIGFTR
IIPNYTMSFMPI
Number of residues
492
Molecular Weight
56344.975
Theoretical pI
Not Available
GO Classification
Functions
arachidonic acid epoxygenase activity / aromatase activity / heme binding / iron ion binding / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / oxygen binding / steroid hydroxylase activity
Processes
coumarin metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / oxidation-reduction process / xenobiotic metabolic process
Components
cytoplasm / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Steroid hydroxylase activity
Specific Function
Highly active in the 15-alpha-hydroxylation of testosterone.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0013305|Cytochrome P450 2A2 (Cyp2a2)
ATGCTGGACACAGGACTGCTCCTGGTGGTCATACTGGCCTCCCTAAGTGTCATGTTCTTG
GTGTCCCTCTGGCAGCAGAAAATCAGGGAGAGATTGCCTCCAGGACCCACTCCTTTGCCT
TTCATTGGAAATTATCTGCAGCTGAATATGAAAGACGTATACAGTTCCATCACACAGCTC
AGTGAGCGCTATGGTCCTGTGTTCACCATTCACCTTGGGCCTCGACGGATTGTTGTGCTT
TATGGATACGATGCAGTCAAAGAGGCTTTGGTGGACCAAGCTGAGGAGTTCAGTGGACGT
GGCGAACTGCCTACCTTTAATATACTCTTCAAAGGCTATGGTTTTTCATTGAGCAATGTG
GAACAGGCCAAGCGTATCAGGCGCTTCACCATAGCCACATTGAGAGATTTTGGTGTGGGC
AAGCGTGATGTACAGGAGTGTATCCTGGAGGAGGCAGGCTATTTGATCAAGACGTTGCAG
GGCACTTGTGGAGCCCCCATTGACCCTTCCATCTACCTGAGCAAAACAGTCTCCAATGTC
ATTAACTCCATTGTCTTCGGGAACCGCTTCGACTATGAGGACAAAGAGTTCTTGTCACTG
TTGGAGATGATCGATGAAATGAATATATTTGCAGCCTCAGCCACAGGGCAGCTCTATGAC
ATGTTCCATTCAGTGATGAAGTACCTGCCTGGACCACAGCAACAGATCATCAAGGTTACT
CAGAAACTGGAAGACTTCATGATAGAGAAAGTGAGGCAGAACCATAGTACCCTGGACCCC
AATTCCCCAAGGAACTTCATTGACTCCTTTCTCATCCGCATGCAAGAGGAGAAATATGTT
AATTCAGAATTCCACATGAACAACCTAGTGATGTCATCATTAGGCCTCCTCTTTGCTGGG
ACTGGGTCAGTCAGCTCCACGCTATACCATGGTTTCCTGCTACTCATGAAGCATCCAGAT
GTGGAAGCCAAGGTCCATGAGGAAATTGAGCGAGTGATCGGCAGGAACCGACAGCCTCAG
TATGAGGACCACATGAAGATGCCCTACACCCAGGCTGTGATCAATGAGATCCAAAGATTT
TCTAACTTGGCTCCCTTGGGCATTCCTCGAAGGATTATCAAGAACACAACCTTCCGTGGC
TTCTTCCTCCCCAAGGGCACCGATGTATTCCCTATAATAGGTTCTCTGATGACAGAACCA
AAGTTCTTCCCTAACCACAAAGACTTCAACCCCCAGCACTTCCTGGATGACAAGGGACAG
TTGAAGAAGAATGCTGCATTTCTCCCTTTTTCCATTGGAAAGCGATTCTGCTTGGGAGAT
AGCCTGGCTAAAATGGAGCTCTTCCTGCTGCTCACCACCATCTTGCAGAACTTCCGTTTT
AAGTTCCCAATGAATCTAGAAGACATCAACGAGTACCCCAGTCCCATAGGGTTTACCAGG
ATCATACCAAATTACACCATGAGCTTCATGCCCATCTGA
Chromosome Location
1
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP15149
UniProtKB Entry NameCP2A2_RAT
General References
  1. Matsunaga T, Nagata K, Holsztynska EJ, Lapenson DP, Smith A, Kato R, Gelboin HV, Waxman DJ, Gonzalez FJ: Gene conversion and differential regulation in the rat P-450 IIA gene subfamily. Purification, catalytic activity, cDNA and deduced amino acid sequence, and regulation of an adult male-specific hepatic testosterone 15 alpha-hydroxylase. J Biol Chem. 1988 Dec 5;263(34):17995-8002. [Article]
  2. Matsunaga T, Nomoto M, Kozak CA, Gonzalez FJ: Structure and in vitro transcription of the rat CYP2A1 and CYP2A2 genes and regional localization of the CYP2A gene subfamily on mouse chromosome 7. Biochemistry. 1990 Feb 6;29(5):1329-41. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Matsumoto T, Emi Y, Kawabata S, Omura T: Purification and characterization of three male-specific and one female-specific forms of cytochrome P-450 from rat liver microsomes. J Biochem. 1986 Nov;100(5):1359-71. [Article]
  5. Arlotto MP, Greenway DJ, Parkinson A: Purification of two isozymes of rat liver microsomal cytochrome P450 with testosterone 7 alpha-hydroxylase activity. Arch Biochem Biophys. 1989 May 1;270(2):441-57. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08834Tauroursodeoxycholic acidexperimental, investigationalunknowninducerDetails