Mucin-1
Details
- Name
- Mucin-1
- Synonyms
- Breast carcinoma-associated antigen DF3
- CA 15-3
- Cancer antigen 15-3
- Carcinoma-associated mucin
- EMA
- Episialin
- H23AG
- KL-6
- Krebs von den Lungen-6
- MUC-1
- Peanut-reactive urinary mucin
- PEM
- PEMT
- Polymorphic epithelial mucin
- PUM
- Tumor-associated epithelial membrane antigen
- Tumor-associated mucin
- Gene Name
- MUC1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0037241|Mucin-1 MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSV LSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTS APDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTS ASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHS SVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQI YKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVS VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPAR DTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
- Number of residues
- 1255
- Molecular Weight
- 122100.89
- Theoretical pI
- 7.48
- GO Classification
- Functionsp53 binding / RNA polymerase II core promoter proximal region sequence-specific DNA binding / transcription cofactor activityProcessescellular protein metabolic process / DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest / DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator / negative regulation of cell adhesion mediated by integrin / negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator / negative regulation of transcription by competitive promoter binding / O-glycan processing / positive regulation of histone H4 acetylation / positive regulation of transcription from RNA polymerase II promoter in response to stress / post-translational protein modification / protein O-linked glycosylation / regulation of transcription from RNA polymerase II promoter in response to stressComponentsapical plasma membrane / extracellular exosome / extracellular space / Golgi lumen / integral component of plasma membrane / nuclear chromatin / vesicle
- General Function
- Transcription cofactor activity
- Specific Function
- The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.
- Pfam Domain Function
- SEA (PF01390)
- Transmembrane Regions
- 1159-1181
- Cellular Location
- Apical cell membrane
- Gene sequence
>lcl|BSEQ0017122|Mucin-1 (MUC1) ATGACACCGGGCACCCAGTCTCCTTTCTTCCTGCTGCTGCTCCTCACAGTGCTTACAGCT ACCACAGCCCCTAAACCCGCAACAGTTGTTACGGGTTCTGGTCATGCAAGCTCTACCCCA GGTGGAGAAAAGGAGACTTCGGCTACCCAGAGAAGTTCAGTGCCCAGCTCTACTGAGAAG AATGCTTTTAATTCCTCTCTGGAAGATCCCAGCACCGACTACTACCAAGAGCTGCAGAGA GACATTTCTGAAATGTTTTTGCAGATTTATAAACAAGGGGGTTTTCTGGGCCTCTCCAAT ATTAAGTTCAGGCCAGGATCTGTGGTGGTACAATTGACTCTGGCCTTCCGAGAAGGTACC ATCAATGTCCACGACGTGGAGACACAGTTCAATCAGTATAAAACGGAAGCAGCCTCTCGA TATAACCTGACGATCTCAGACGTCAGCGTGAGTGATGTGCCATTTCCTTTCTCTGCCCAG TCTGGGGCTGGGGTGCCAGGCTGGGGCATCGCGCTGCTGGTGCTGGTCTGTGTTCTGGTT GCGCTGGCCATTGTCTATCTCATTGCCTTGGCTGTCTGTCAGTGCCGCCGAAAGAACTAC GGGCAGCTGGACATCTTTCCAGCCCGGGATACCTACCATCCTATGAGCGAGTACCCCACC TACCACACCCATGGGCGCTATGTGCCCCCTAGCAGTACCGATCGTAGCCCCTATGAGAAG GTTTCTGCAGGTAATGGTGGCAGCAGCCTCTCTTACACAAACCCAGCAGTGGCAGCCACT TCTGCCAACTTGTAG
- Chromosome Location
- 1
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P15941 UniProtKB Entry Name MUC1_HUMAN GenBank Gene ID M21868 GenAtlas ID MUC1 HGNC ID HGNC:7508 - General References
- Lan MS, Batra SK, Qi WN, Metzgar RS, Hollingsworth MA: Cloning and sequencing of a human pancreatic tumor mucin cDNA. J Biol Chem. 1990 Sep 5;265(25):15294-9. [Article]
- Ligtenberg MJ, Vos HL, Gennissen AM, Hilkens J: Episialin, a carcinoma-associated mucin, is generated by a polymorphic gene encoding splice variants with alternative amino termini. J Biol Chem. 1990 Apr 5;265(10):5573-8. [Article]
- Gendler SJ, Lancaster CA, Taylor-Papadimitriou J, Duhig T, Peat N, Burchell J, Pemberton L, Lalani EN, Wilson D: Molecular cloning and expression of human tumor-associated polymorphic epithelial mucin. J Biol Chem. 1990 Sep 5;265(25):15286-93. [Article]
- Lancaster CA, Peat N, Duhig T, Wilson D, Taylor-Papadimitriou J, Gendler SJ: Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit. Biochem Biophys Res Commun. 1990 Dec 31;173(3):1019-29. [Article]
- Wreschner DH, Hareuveni M, Tsarfaty I, Smorodinsky N, Horev J, Zaretsky J, Kotkes P, Weiss M, Lathe R, Dion A, et al.: Human epithelial tumor antigen cDNA sequences. Differential splicing may generate multiple protein forms. Eur J Biochem. 1990 May 20;189(3):463-73. [Article]
- Hareuveni M, Tsarfaty I, Zaretsky J, Kotkes P, Horev J, Zrihan S, Weiss M, Green S, Lathe R, Keydar I, et al.: A transcribed gene, containing a variable number of tandem repeats, codes for a human epithelial tumor antigen. cDNA cloning, expression of the transfected gene and over-expression in breast cancer tissue. Eur J Biochem. 1990 May 20;189(3):475-86. [Article]
- Tsarfaty I, Hareuveni M, Horev J, Zaretsky J, Weiss M, Jeltsch JM, Garnier JM, Lathe R, Keydar I, Wreschner DH: Isolation and characterization of an expressed hypervariable gene coding for a breast-cancer-associated antigen. Gene. 1990 Sep 14;93(2):313-8. [Article]
- Zrihan-Licht S, Vos HL, Baruch A, Elroy-Stein O, Sagiv D, Keydar I, Hilkens J, Wreschner DH: Characterization and molecular cloning of a novel MUC1 protein, devoid of tandem repeats, expressed in human breast cancer tissue. Eur J Biochem. 1994 Sep 1;224(2):787-95. [Article]
- Oosterkamp HM, Scheiner L, Stefanova MC, Lloyd KO, Finstad CL: Comparison of MUC-1 mucin expression in epithelial and non-epithelial cancer cell lines and demonstration of a new short variant form (MUC-1/Z). Int J Cancer. 1997 Jul 3;72(1):87-94. [Article]
- Levitin F, Baruch A, Weiss M, Stiegman K, Hartmann ML, Yoeli-Lerner M, Ziv R, Zrihan-Licht S, Shina S, Gat A, Lifschitz B, Simha M, Stadler Y, Cholostoy A, Gil B, Greaves D, Keydar I, Zaretsky J, Smorodinsky N, Wreschner DH: A novel protein derived from the MUC1 gene by alternative splicing and frameshifting. J Biol Chem. 2005 Mar 18;280(11):10655-63. Epub 2004 Dec 28. [Article]
- Zhang L, Vlad A, Milcarek C, Finn OJ: Human mucin MUC1 RNA undergoes different types of alternative splicing resulting in multiple isoforms. Cancer Immunol Immunother. 2013 Mar;62(3):423-35. doi: 10.1007/s00262-012-1325-2. Epub 2012 Sep 2. [Article]
- Zhang LX, Li CH, Sun LY, Wang M, Lu HJ: [Soluble expression of peptide containing MUC1/Y-specific epitope in Escherichia coli and preparation of the antibody]. Sheng Wu Gong Cheng Xue Bao. 2003 May;19(3):337-42. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Gendler S, Taylor-Papadimitriou J, Duhig T, Rothbard J, Burchell J: A highly immunogenic region of a human polymorphic epithelial mucin expressed by carcinomas is made up of tandem repeats. J Biol Chem. 1988 Sep 15;263(26):12820-3. [Article]
- Abe M, Siddiqui J, Kufe D: Sequence analysis of the 5' region of the human DF3 breast carcinoma-associated antigen gene. Biochem Biophys Res Commun. 1989 Dec 15;165(2):644-9. [Article]
- Weiss M, Baruch A, Keydar I, Wreschner DH: Preoperative diagnosis of thyroid papillary carcinoma by reverse transcriptase polymerase chain reaction of the MUC1 gene. Int J Cancer. 1996 Mar 28;66(1):55-9. [Article]
- Yu CJ, Yang PC, Shew JY, Hong TM, Yang SC, Lee YC, Lee LN, Luh KT, Wu CW: Mucin mRNA expression in lung adenocarcinoma cell lines and tissues. Oncology. 1996 Mar-Apr;53(2):118-26. [Article]
- Parry S, Silverman HS, McDermott K, Willis A, Hollingsworth MA, Harris A: Identification of MUC1 proteolytic cleavage sites in vivo. Biochem Biophys Res Commun. 2001 May 11;283(3):715-20. [Article]
- Levitin F, Stern O, Weiss M, Gil-Henn C, Ziv R, Prokocimer Z, Smorodinsky NI, Rubinstein DB, Wreschner DH: The MUC1 SEA module is a self-cleaving domain. J Biol Chem. 2005 Sep 30;280(39):33374-86. Epub 2005 Jun 29. [Article]
- Muller S, Alving K, Peter-Katalinic J, Zachara N, Gooley AA, Hanisch FG: High density O-glycosylation on tandem repeat peptide from secretory MUC1 of T47D breast cancer cells. J Biol Chem. 1999 Jun 25;274(26):18165-72. [Article]
- Zrihan-Licht S, Baruch A, Elroy-Stein O, Keydar I, Wreschner DH: Tyrosine phosphorylation of the MUC1 breast cancer membrane proteins. Cytokine receptor-like molecules. FEBS Lett. 1994 Dec 12;356(1):130-6. [Article]
- Pandey P, Kharbanda S, Kufe D: Association of the DF3/MUC1 breast cancer antigen with Grb2 and the Sos/Ras exchange protein. Cancer Res. 1995 Sep 15;55(18):4000-3. [Article]
- Stadie TR, Chai W, Lawson AM, Byfield PG, Hanisch FG: Studies on the order and site specificity of GalNAc transfer to MUC1 tandem repeats by UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase from milk or mammary carcinoma cells. Eur J Biochem. 1995 Apr 1;229(1):140-7. [Article]
- Yamamoto M, Bharti A, Li Y, Kufe D: Interaction of the DF3/MUC1 breast carcinoma-associated antigen and beta-catenin in cell adhesion. J Biol Chem. 1997 May 9;272(19):12492-4. [Article]
- Muller S, Goletz S, Packer N, Gooley A, Lawson AM, Hanisch FG: Localization of O-glycosylation sites on glycopeptide fragments from lactation-associated MUC1. All putative sites within the tandem repeat are glycosylation targets in vivo. J Biol Chem. 1997 Oct 3;272(40):24780-93. [Article]
- Reid CJ, Harris A: Developmental expression of mucin genes in the human gastrointestinal system. Gut. 1998 Feb;42(2):220-6. [Article]
- Hanisch FG, Green BN, Bateman R, Peter-Katalinic J: Localization of O-glycosylation sites of MUC1 tandem repeats by QTOF ESI mass spectrometry. J Mass Spectrom. 1998 Apr;33(4):358-62. [Article]
- Li Y, Bharti A, Chen D, Gong J, Kufe D: Interaction of glycogen synthase kinase 3beta with the DF3/MUC1 carcinoma-associated antigen and beta-catenin. Mol Cell Biol. 1998 Dec;18(12):7216-24. [Article]
- Baruch A, Hartmann M, Yoeli M, Adereth Y, Greenstein S, Stadler Y, Skornik Y, Zaretsky J, Smorodinsky NI, Keydar I, Wreschner DH: The breast cancer-associated MUC1 gene generates both a receptor and its cognate binding protein. Cancer Res. 1999 Apr 1;59(7):1552-61. [Article]
- Hayashi T, Takahashi T, Motoya S, Ishida T, Itoh F, Adachi M, Hinoda Y, Imai K: MUC1 mucin core protein binds to the domain 1 of ICAM-1. Digestion. 2001;63 Suppl 1:87-92. [Article]
- Bennett R Jr, Jarvela T, Engelhardt P, Kostamovaara L, Sparks P, Carpen O, Turunen O, Vaheri A: Mucin MUC1 is seen in cell surface protrusions together with ezrin in immunoelectron tomography and is concentrated at tips of filopodial protrusions in MCF-7 breast carcinoma cells. J Histochem Cytochem. 2001 Jan;49(1):67-77. [Article]
- Li Y, Kuwahara H, Ren J, Wen G, Kufe D: The c-Src tyrosine kinase regulates signaling of the human DF3/MUC1 carcinoma-associated antigen with GSK3 beta and beta-catenin. J Biol Chem. 2001 Mar 2;276(9):6061-4. Epub 2001 Jan 10. [Article]
- Engelmann K, Baldus SE, Hanisch FG: Identification and topology of variant sequences within individual repeat domains of the human epithelial tumor mucin MUC1. J Biol Chem. 2001 Jul 27;276(30):27764-9. Epub 2001 May 11. [Article]
- Li Y, Ren J, Yu W, Li Q, Kuwahara H, Yin L, Carraway KL 3rd, Kufe D: The epidermal growth factor receptor regulates interaction of the human DF3/MUC1 carcinoma antigen with c-Src and beta-catenin. J Biol Chem. 2001 Sep 21;276(38):35239-42. Epub 2001 Aug 1. [Article]
- Ren J, Li Y, Kufe D: Protein kinase C delta regulates function of the DF3/MUC1 carcinoma antigen in beta-catenin signaling. J Biol Chem. 2002 May 17;277(20):17616-22. Epub 2002 Mar 4. [Article]
- Wang H, Lillehoj EP, Kim KC: Identification of four sites of stimulated tyrosine phosphorylation in the MUC1 cytoplasmic tail. Biochem Biophys Res Commun. 2003 Oct 17;310(2):341-6. [Article]
- Li Y, Chen W, Ren J, Yu WH, Li Q, Yoshida K, Kufe D: DF3/MUC1 signaling in multiple myeloma cells is regulated by interleukin-7. Cancer Biol Ther. 2003 Mar-Apr;2(2):187-93. [Article]
- Huang L, Ren J, Chen D, Li Y, Kharbanda S, Kufe D: MUC1 cytoplasmic domain coactivates Wnt target gene transcription and confers transformation. Cancer Biol Ther. 2003 Nov-Dec;2(6):702-6. [Article]
- Thathiah A, Blobel CP, Carson DD: Tumor necrosis factor-alpha converting enzyme/ADAM 17 mediates MUC1 shedding. J Biol Chem. 2003 Jan 31;278(5):3386-94. Epub 2002 Nov 18. [Article]
- Wen Y, Caffrey TC, Wheelock MJ, Johnson KR, Hollingsworth MA: Nuclear association of the cytoplasmic tail of MUC1 and beta-catenin. J Biol Chem. 2003 Sep 26;278(39):38029-39. Epub 2003 Jun 27. [Article]
- Li Y, Yu WH, Ren J, Chen W, Huang L, Kharbanda S, Loda M, Kufe D: Heregulin targets gamma-catenin to the nucleolus by a mechanism dependent on the DF3/MUC1 oncoprotein. Mol Cancer Res. 2003 Aug;1(10):765-75. [Article]
- Kinlough CL, Poland PA, Bruns JB, Harkleroad KL, Hughey RP: MUC1 membrane trafficking is modulated by multiple interactions. J Biol Chem. 2004 Dec 17;279(51):53071-7. Epub 2004 Oct 7. [Article]
- Wei X, Xu H, Kufe D: Human MUC1 oncoprotein regulates p53-responsive gene transcription in the genotoxic stress response. Cancer Cell. 2005 Feb;7(2):167-78. [Article]
- Huang L, Chen D, Liu D, Yin L, Kharbanda S, Kufe D: MUC1 oncoprotein blocks glycogen synthase kinase 3beta-mediated phosphorylation and degradation of beta-catenin. Cancer Res. 2005 Nov 15;65(22):10413-22. [Article]
- Engelmann K, Kinlough CL, Muller S, Razawi H, Baldus SE, Hughey RP, Hanisch FG: Transmembrane and secreted MUC1 probes show trafficking-dependent changes in O-glycan core profiles. Glycobiology. 2005 Nov;15(11):1111-24. Epub 2005 Jun 22. [Article]
- Mukherjee P, Tinder TL, Basu GD, Gendler SJ: MUC1 (CD227) interacts with lck tyrosine kinase in Jurkat lymphoma cells and normal T cells. J Leukoc Biol. 2005 Jan;77(1):90-9. Epub 2004 Oct 28. [Article]
- Kinlough CL, McMahan RJ, Poland PA, Bruns JB, Harkleroad KL, Stremple RJ, Kashlan OB, Weixel KM, Weisz OA, Hughey RP: Recycling of MUC1 is dependent on its palmitoylation. J Biol Chem. 2006 Apr 28;281(17):12112-22. Epub 2006 Feb 28. [Article]
- Wei X, Xu H, Kufe D: MUC1 oncoprotein stabilizes and activates estrogen receptor alpha. Mol Cell. 2006 Jan 20;21(2):295-305. [Article]
- Lillehoj EP, Lu W, Kiser T, Goldblum SE, Kim KC: MUC1 inhibits cell proliferation by a beta-catenin-dependent mechanism. Biochim Biophys Acta. 2007 Jul;1773(7):1028-38. Epub 2007 Apr 22. [Article]
- Wei X, Xu H, Kufe D: Human mucin 1 oncoprotein represses transcription of the p53 tumor suppressor gene. Cancer Res. 2007 Feb 15;67(4):1853-8. [Article]
- Singh PK, Wen Y, Swanson BJ, Shanmugam K, Kazlauskas A, Cerny RL, Gendler SJ, Hollingsworth MA: Platelet-derived growth factor receptor beta-mediated phosphorylation of MUC1 enhances invasiveness in pancreatic adenocarcinoma cells. Cancer Res. 2007 Jun 1;67(11):5201-10. [Article]
- Pochampalli MR, el Bejjani RM, Schroeder JA: MUC1 is a novel regulator of ErbB1 receptor trafficking. Oncogene. 2007 Mar 15;26(12):1693-701. Epub 2006 Sep 18. [Article]
- Duffy MJ, Evoy D, McDermott EW: CA 15-3: uses and limitation as a biomarker for breast cancer. Clin Chim Acta. 2010 Dec 14;411(23-24):1869-74. doi: 10.1016/j.cca.2010.08.039. Epub 2010 Sep 8. [Article]
- Kirby A, Gnirke A, Jaffe DB, Baresova V, Pochet N, Blumenstiel B, Ye C, Aird D, Stevens C, Robinson JT, Cabili MN, Gat-Viks I, Kelliher E, Daza R, DeFelice M, Hulkova H, Sovova J, Vylet'al P, Antignac C, Guttman M, Handsaker RE, Perrin D, Steelman S, Sigurdsson S, Scheinman SJ, Sougnez C, Cibulskis K, Parkin M, Green T, Rossin E, Zody MC, Xavier RJ, Pollak MR, Alper SL, Lindblad-Toh K, Gabriel S, Hart PS, Regev A, Nusbaum C, Kmoch S, Bleyer AJ, Lander ES, Daly MJ: Mutations causing medullary cystic kidney disease type 1 lie in a large VNTR in MUC1 missed by massively parallel sequencing. Nat Genet. 2013 Mar;45(3):299-303. doi: 10.1038/ng.2543. Epub 2013 Feb 10. [Article]
- Parry S, Hanisch FG, Leir SH, Sutton-Smith M, Morris HR, Dell A, Harris A: N-Glycosylation of the MUC1 mucin in epithelial cells and secretions. Glycobiology. 2006 Jul;16(7):623-34. Epub 2006 Apr 3. [Article]