Synapsin-1

Details

Name
Synapsin-1
Synonyms
  • Brain protein 4.1
  • Synapsin I
Gene Name
SYN1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009409|Synapsin-1
MNYLRRRLSDSNFMANLPNGYMTDLQRPQPPPPPPGAHSPGATPGPGTATAERSSGVAPA
ASPAAPSPGSSGGGGFFSSLSNAVKQTTAAAAATFSEQVGGGSGGAGRGGAASRVLLVID
EPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKP
DFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLG
TEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKT
YATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTC
SEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR
QRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPP
LQQRPPPQGQQHLSGLGPPAGSPLPQRLPSPTSAPQQPASQAAPPTQGQGRQSRPVAGGP
GAPPAARPPASPSPQRQAGPPQATRQTSVSGPAPPKASGAPPGGQQRQGPPQKPPGPAGP
TRQASQAGPVPRTGPPTTQQPRPSGPGPAGRPKPQLAQKPSQDVPPPATAAAGGPPHPQL
NKSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD
Number of residues
705
Molecular Weight
74110.97
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / catalytic activity / protein kinase binding / transporter activity
Processes
neurotransmitter secretion / regulation of neurotransmitter secretion / regulation of synaptic vesicle exocytosis / synaptic transmission
Components
cell junction / cytosol / dendrite / Golgi apparatus / myelin sheath / presynaptic active zone / synaptic vesicle / synaptic vesicle membrane / terminal bouton
General Function
Transporter activity
Specific Function
Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0021388|Synapsin-1 (SYN1)
ATGAACTACCTGCGGCGCCGCCTGTCGGACAGCAACTTTATGGCCAATCTGCCAAATGGG
TACATGACAGACCTGCAGCGTCCGCAGCCGCCCCCACCGCCGCCCGGTGCCCACAGCCCC
GGAGCCACGCCCGGTCCCGGGACCGCCACTGCCGAGAGGTCCTCCGGGGTCGCCCCAGCG
GCCTCTCCGGCCGCCCCTAGCCCCGGGTCCTCGGGGGGCGGTGGCTTCTTCTCGTCGCTG
TCCAACGCGGTCAAGCAGACCACGGCGGCGGCAGCTGCCACCTTCAGCGAGCAGGTGGGC
GGCGGCTCTGGGGGCGCAGGCCGCGGGGGAGCCGCCTCCAGGGTGCTGCTGGTCATCGAC
GAGCCGCACACCGACTGGGCAAAATACTTCAAAGGGAAAAAGATCCATGGAGAAATTGAC
ATTAAAGTAGAACAGGCCGAATTCTCTGATCTCAACCTTGTGGCCCATGCCAATGGTGGA
TTCTCTGTGGATATGGAAGTTCTTCGGAATGGGGTGAAGGTCGTGCGGTCTCTGAAGCCG
GATTTTGTGCTGATCCGCCAGCACGCCTTCAGCATGGCACGCAACGGAGACTACCGCAGT
TTGGTCATTGGGCTGCAGTATGCTGGAATCCCCAGTGTTAACTCCTTGCATTCTGTCTAC
AACTTCTGTGACAAGCCCTGGGTGTTTGCCCAGATGGTTCGACTGCATAAGAAACTGGGG
ACAGAAGAATTCCCTCTAATTGATCAGACCTTCTACCCCAATCACAAAGAAATGCTCAGC
AGTACAACGTACCCCGTGGTTGTGAAGATGGGGCACGCACACTCTGGGATGGGCAAGGTC
AAGGTTGACAACCAGCATGACTTCCAGGACATCGCAAGTGTCGTGGCACTGACCAAGACG
TATGCCACTGCCGAGCCCTTCATCGATGCCAAATATGACGTGCGTGTCCAGAAGATTGGG
CAGAACTACAAGGCCTACATGAGGACGTCAGTGTCAGGGAACTGGAAGACCAATACTGGC
TCTGCGATGCTGGAGCAAATTGCCATGTCTGACAGATACAAGCTGTGGGTGGACACGTGC
TCAGAGATTTTTGGGGGACTGGACATCTGCGCAGTGGAAGCGCTACATGGCAAGGACGGA
AGGGATCACATCATTGAGGTGGTGGGTTCCTCCATGCCGCTCATTGGTGACCACCAGGAT
GAAGACAAACAGCTCATCGTAGAGCTCGTGGTCAACAAGATGGCTCAGGCCCTGCCCCGG
CAGCGACAGCGGGATGCCTCCCCTGGCAGGGGCTCCCATGGCCAGACTCCGTCCCCAGGG
GCCCTGCCCTTGGGCCGCCAGACCTCCCAGCAGCCCGCAGGGCCCCCGGCTCAGCAGCGA
CCCCCACCACAGGGCGGCCCTCCACAGCCGGGTCCAGGCCCCCAGCGCCAGGGACCCCCA
TTGCAGCAGCGCCCGCCCCCGCAGGGCCAGCAGCACCTTTCAGGCCTTGGACCCCCAGCT
GGCAGCCCCCTGCCCCAGCGCCTTCCAAGTCCCACCTCAGCGCCCCAGCAGCCCGCGTCC
CAGGCCGCGCCGCCGACCCAGGGTCAAGGCCGCCAATCCCGGCCAGTGGCGGGAGGCCCC
GGGGCGCCTCCAGCAGCCCGCCCGCCCGCCTCTCCGTCTCCCCAGCGCCAGGCGGGCCCC
CCACAGGCTACCCGTCAGACATCCGTCTCTGGCCCGGCTCCGCCAAAGGCCTCTGGGGCC
CCACCGGGCGGGCAGCAGCGCCAGGGCCCGCCCCAGAAACCCCCAGGCCCAGCCGGCCCC
ACACGCCAGGCCAGCCAGGCGGGTCCCGTGCCCCGCACTGGGCCACCCACCACGCAGCAG
CCTCGGCCCAGCGGCCCGGGCCCCGCTGGACGTCCCAAACCACAGCTGGCCCAGAAACCC
AGCCAGGACGTGCCGCCACCCGCCACCGCCGCTGCAGGGGGACCTCCGCACCCCCAGCTC
AACAAATCCCAGTCTCTGACCAATGCCTTCAACCTTCCAGAGCCAGCCCCGCCCAGGCCC
AGCCTTAGCCAGGACGAGGTGAAAGCTGAGACCATCCGCAGCCTGAGGAAGTCTTTCGCC
AGCCTCTTCTCCGACTGA
Chromosome Location
X
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP17600
UniProtKB Entry NameSYN1_HUMAN
HGNC IDHGNC:11494
General References
  1. Sudhof TC: The structure of the human synapsin I gene and protein. J Biol Chem. 1990 May 15;265(14):7849-52. [PubMed:2110562]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651]
  3. Sauerwald A, Hoesche C, Oschwald R, Kilimann MW: The 5'-flanking region of the synapsin I gene. A G+C-rich, TATA- and CAAT-less, phylogenetically conserved sequence with cell type-specific promoter function. J Biol Chem. 1990 Sep 5;265(25):14932-7. [PubMed:2118519]
  4. Garcia CC, Blair HJ, Seager M, Coulthard A, Tennant S, Buddles M, Curtis A, Goodship JA: Identification of a mutation in synapsin I, a synaptic vesicle protein, in a family with epilepsy. J Med Genet. 2004 Mar;41(3):183-6. [PubMed:14985377]
  5. DeGiorgis JA, Jaffe H, Moreira JE, Carlotti CG Jr, Leite JP, Pant HC, Dosemeci A: Phosphoproteomic analysis of synaptosomes from human cerebral cortex. J Proteome Res. 2005 Mar-Apr;4(2):306-15. [PubMed:15822905]
  6. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02930Adenosine 5'-[gamma-thio]triphosphateexperimentalunknownDetails