Maltogenic alpha-amylase

Details

Name
Maltogenic alpha-amylase
Synonyms
  • 3.2.1.133
  • Glucan 1,4-alpha-maltohydrolase
Gene Name
amyM
Organism
Geobacillus stearothermophilus
Amino acid sequence
>lcl|BSEQ0011167|Maltogenic alpha-amylase
MKKKTLSLFVGLMLLIGLLFSGSLPYNPNAAEASSSASVKGDVIYQIIIDRFYDGDTTNN
NPAKSYGLYDPTKSKWKMYWGGDLEGVRQKLPYLKQLGVTTIWLSPVLDNLDTLAGTDNT
GYHGYWTRDFKQIEEHFGNWTTFDTLVNDAHQNGIKVIVDFVPNHSTPFKANDSTFAEGG
ALYNNGTYMGNYFDDATKGYFHHNGDISNWDDRYEAQWKNFTDPAGFSLADLSQENGTIA
QYLTDAAVQLVAHGADGLRIDAVKHFNSGFSKSLADKLYQKKDIFLVGEWYGDDPGTANH
LEKVRYANNSGVNVLDFDLNTVIRNVFGTFTQTMYDLNNMVNQTGNEYKYKENLITFIDN
HDMSRFLSVNSNKANLHQALAFILTSRGTPSIYYGTEQYMAGGNDPYNRGMMPAFDTTTT
AFKEVSTLAGLRRNNAAIQYGTTTQRWINNDVYIYERKFFNDVVLVAINRNTQSSYSISG
LQTALPNGSYADYLSGLLGGNGISVSNGSVASFTLAPGAVSVWQYSTSASAPQIGSVAPN
MGIPGNVVTIDGKGFGTTQGTVTFGGVTATVKSWTSNRIEVYVPNMAAGLTDVKVTAGGV
SSNLYSYNILSGTQTSVVFTVKSAPPTNLGDKIYLTGNIPELGNWSTDTSGAVNNAQGPL
LAPNYPDWFYVFSVPAGKTIQFKFFIKRADGTIQWENGSNHVATTPTGATGNITVTWQN
Number of residues
719
Molecular Weight
78675.13
Theoretical pI
5.95
GO Classification
Functions
glucan 1,4-alpha-maltohydrolase activity / metal ion binding / starch binding
Processes
carbohydrate metabolic process
General Function
Starch binding
Specific Function
Converts starch into maltose.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0003250|2154 bp
ATGAAAAAGAAAACGCTTTCTTTATTTGTGGGACTGATGCTCCTCATCGGTCTTCTGTTC
AGCGGTTCTCTTCCGTACAATCCAAACGCCGCTGAAGCCAGCAGTTCCGCAAGCGTCAAA
GGGGACGTGATTTACCAGATTATCATTGACCGGTTTTACGATGGGGACACGACGAACAAC
AATCCTGCCAAAAGTTATGGACTTTACGATCCTACCAAATCGAAGTGGAAAATGTATTGG
GGCGGGGATCTGGAGGGGGTTCGTCAAAAACTTCCTTATCTTAAACAGCTGGGCGTAACG
ACAATCTGGTTGTCCCCGGTTTTGAACAATCTGGATACACTGGCGGGCACCGATAACACG
GGCTATCACGGATACTGGACGCGCGATTTTAAACAGATTGAGGAACATTTCGGGAATTGG
ACCACATTTGACACGTTGGTCAATGATGCTCACCAAAACGGAATCAAGGTGATTGTCGAC
TTTGTGCCCAATCATTCGACTCCTTTTAAGGCAAACGATTCCACCTTTGCGGAAGGCGGC
GCCCTCTACAACAATGGAACCTATATGGGCAATTATTTTGATGACGCAACAAAAGGGTAC
TTCCACCATAATGGGGACATCAGCAACTGGGACGACCGGTACGAGGCGCAATGGAAAAAC
TTCACGGATCCAGCCGGTTTCTCGCTTGCCGATTTGTCGCAGGAAAATGGCACGATTGCT
CAATACCTGACCGATGCGGCGGTTCAATTGGTAGCACATGGTTTGCGGATTGATGCGGTG
AAGCATTTTAATTCGGGGTTCTCCAAATCGTTGGCCGATAAACTGTACCAAAAGAAAGAC
ATTTTCCTGGTGGGGGAATGGTACGGAGATGACCCCGGAACAGCCAATCATCTGGAAAAG
GTCCGGTACGCCAACAACAGCGGTGTCAATGTGCTGGATTTTGATCTCAACACGGTGATT
CGAAATGTGTTCGGCACATTTACGCAAACGATGTACGATCTTAACAATATGGTGAACCAA
ACGGGGAACGAGTACAAATACAAAGAAAATCTAATCACATTTATCGATAACCATGATATG
TCAAGATTTCTTTCGGTAAATTCGAAGAACAAGGCGAATTTGCACCAGCGCTTGCTTTCA
TTCTCACTTCGCGGGGTACGCCCTCCCATCTATTATGGAACCGAACAATACATGGCAGGC
GGCAATGACCCGTACAACCGGGGGATGATGCCGGCGTTTGATACGACAACCACCGCCTTT
AAAGAGGTGTCAACTCTGGCGGGGTTGCGCAGGAACAATGCGGCGATCCAGTACGGCACC
ACCACCCAGCGCTGGATCAACAATGATGTTTACATTTATGAACGGAAATTTTTCAACGAT
GTCGTGTTGGTGGCCATCAATCGAAACACGCAATCCTCCTATTCGATTTCCGGTTTGCAG
ACGGCCTTGCCAAATGGCAGCTATGCGGATTATCTGTCAGGGCTGTTGGGGGGGAACGGG
ATTTCCGTTTCCAATGGAAGTGTCGCTTCGTTCACGCTTGCGCCTGGAGCCGTGTCTGTT
TGGCAGTACAGCACATCCGCTTCAGCGCCGCAAATCGGATCGGTTGCTCCAAATATGGGG
ATTCCGGGTAATGTGGTCACGATCGACGGGAAAGGTTTTGGGACGACGCAGGGAACCGTG
ACATTTGGCGGAGTGACAGCGACTGTGAAATCCTGGACATCCAATCGGATTGAAGTGTAC
GTTCCCAACATGGCCGCCGGGCTGACCGATGTGAAAGTCACCGCGGGTGGAGTTTCCAGC
AATCTGTATTCTTACAATATTTTGAGTGGAACGCAGACATCGGTTGTGTTTACTGTGAAA
AGTGCGCCTCCGACCAACCTAGGGGATAAGATTTACCTGACGGGCAACATACCGGAATTG
GGGAATTGGAGCACGGATACGAGCGGAGCCGTTAACAATGCGCAAGGGCCCCTGCTCGCG
CCCAATTATCCGGATTGGTTTTATGTATTCAGCGTTCCAGCAGGAAAGACGATTCAATTC
AAGTTCTTCATCAAGCGTGCGGATGGAACGATTCAATGGGAGAATGGTTCGAACCACGTG
GCCACAACTCCCACGGGTGCAACCGGTAACATTACTGTTACGTGGCAAAACTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP19531
UniProtKB Entry NameAMYM_GEOSE
GenBank Protein ID142501
GenBank Gene IDM36539
General References
  1. Dauter Z, Dauter M, Brzozowski AM, Christensen S, Borchert TV, Beier L, Wilson KS, Davies GJ: X-ray structure of Novamyl, the five-domain "maltogenic" alpha-amylase from Bacillus stearothermophilus: maltose and acarbose complexes at 1.7A resolution. Biochemistry. 1999 Jun 29;38(26):8385-92. [PubMed:10387084]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03323Maltoseexperimental, investigationalunknownDetails
DB03971Acarbose Derived HexasaccharideexperimentalunknownDetails