Calretinin

Details

Name
Calretinin
Synonyms
  • 29 kDa calbindin
  • CAB29
  • CR
Gene Name
CALB2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049513|Calretinin
MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK
SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD
TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL
PVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQL
TNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM
Number of residues
271
Molecular Weight
31539.62
Theoretical pI
Not Available
GO Classification
Functions
calcium ion binding
Processes
regulation of cytosolic calcium ion concentration
Components
cytosol / gap junction / neuron projection / nucleus / synapse / terminal bouton
General Function
Calretinin is a calcium-binding protein which is abundant in auditory neurons.
Specific Function
Calcium ion binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0049514|Calretinin (CALB2)
ATGGCTGGCCCGCAGCAGCAGCCCCCTTACCTGCACCTGGCCGAGCTGACGGCGTCCCAG
TTCCTGGAAATATGGAAGCACTTTGACGCAGACGGAAATGGGTATATTGAAGGTAAAGAG
CTAGAAAACTTTTTCCAAGAGCTGGAGAAGGCAAGGAAAGGCTCTGGCATGATGTCAAAG
AGTGACAACTTTGGAGAAAAGATGAAGGAGTTCATGCAGAAGTATGATAAAAACTCAGAT
GGGAAAATCGAGATGGCAGAGCTGGCGCAGATCCTGCCAACCGAAGAGAACTTCCTTCTG
TGCTTCAGGCAGCACGTGGGCTCCAGCGCCGAGTTTATGGAGGCTTGGCGGAAGTACGAC
ACAGACAGGAGTGGCTACATCGAAGCCAATGAGCTCAAGGGATTCCTGTCAGACCTGCTG
AAGAAGGCGAACCGGCCGTACGATGAGCCCAAGCTCCAGGAATACACCCAAACCATACTA
CGGATGTTTGACTTGAACGGGGATGGCAAATTGGGCCTCTCAGAGATGTCCCGACTCCTG
CCTGTCCAGGAAAACTTCCTGCTTAAATTTCAGGGCATGAAGCTGACCTCAGAGGAGTTT
AACGCGATCTTCACATTTTACGACAAGGATAGAAGCGGCTACATTGACGAGCATGAGCTG
GATGCCCTTTTGAAGGATCTGTACGAGAAAAACAAAAAGGAAATGAATATTCAACAGCTC
ACCAACTACAGAAAGAGCGTCATGTCCTTGGCAGAGGCAGGGAAGCTCTACCGCAAGGAC
CTGGAGATTGTGCTCTGCAGCGAGCCCCCCATGTAA
Chromosome Location
16
Locus
16q22.2
External Identifiers
ResourceLink
UniProtKB IDP22676
UniProtKB Entry NameCALB2_HUMAN
HGNC IDHGNC:1435
General References
  1. Parmentier M: The human calbindins: cDNA and gene cloning. Adv Exp Med Biol. 1989;255:233-40. [PubMed:2618861]
  2. Parmentier M, Lefort A: Structure of the human brain calcium-binding protein calretinin and its expression in bacteria. Eur J Biochem. 1991 Feb 26;196(1):79-85. [PubMed:2001709]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11093Calcium citrateapproved, investigationalunknownligandDetails
DB11348Calcium PhosphateapprovedunknownligandDetails
DB13800Calcium levulinateapproved, experimentalunknownagonistDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails