Ecotin

Details

Name
Ecotin
Synonyms
  • eti
Gene Name
eco
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0005762|Ecotin
MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVEL
LIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAY
LGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Number of residues
162
Molecular Weight
18191.925
Theoretical pI
7.25
GO Classification
Functions
serine-type endopeptidase inhibitor activity
Processes
negative regulation of endopeptidase activity
Components
outer membrane-bounded periplasmic space
General Function
Serine-type endopeptidase inhibitor activity
Specific Function
General inhibitor of pancreatic serine proteases: inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases. The strength of inhibition does not appear to be correlated with a particular protease specificity.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0020646|Ecotin (eco)
ATGAAGACCATTCTACCTGCAGTATTGTTTGCCGCTTTCGCTACCACTTCCGCCTGGGCG
GCAGAAAGCGTCCAGCCACTGGAAAAAATCGCGCCTTATCCACAAGCTGAAAAAGGGATG
AAGCGTCAGGTGATTCAGTTAACCCCGCAAGAAGATGAATCTACCCTGAAAGTAGAACTG
TTAATCGGTCAGACGCTGGAAGTCGATTGCAATTTGCATCGTCTCGGCGGGAAGCTGGAA
AACAAAACGCTGGAAGGCTGGGGCTATGATTATTATGTCTTTGATAAAGTCAGTTCCCCG
GTTTCAACGATGATGGCCTGCCCGGATGGCAAGAAAGAGAAGAAATTTGTCACCGCGTAT
CTGGGCGATGCTGGAATGCTGCGTTACAACAGCAAGCTGCCGATCGTGGTGTATACGCCA
GACAATGTAGATGTGAAGTACCGCGTCTGGAAGGCGGAAGAGAAAATTGACAACGCGGTA
GTTCGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP23827
UniProtKB Entry NameECOT_ECOLI
GenBank Gene IDM60876
General References
  1. McGrath ME, Hines WM, Sakanari JA, Fletterick RJ, Craik CS: The sequence and reactive site of ecotin. A general inhibitor of pancreatic serine proteases from Escherichia coli. J Biol Chem. 1991 Apr 5;266(10):6620-5. [Article]
  2. Lee HR, Seo JH, Kim OM, Lee CS, Suh SW, Hong YM, Tanaka K, Ichihara A, Ha DB, Chung CH: Molecular cloning of the ecotin gene in Escherichia coli. FEBS Lett. 1991 Aug 5;287(1-2):53-6. [Article]
  3. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al.: A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):379-92. [Article]
  4. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
  5. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
  6. Link AJ, Robison K, Church GM: Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis. 1997 Aug;18(8):1259-313. [Article]
  7. VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
  8. McGrath ME, Erpel T, Bystroff C, Fletterick RJ: Macromolecular chelation as an improved mechanism of protease inhibition: structure of the ecotin-trypsin complex. EMBO J. 1994 Apr 1;13(7):1502-7. [Article]
  9. Shin DH, Song HK, Seong IS, Lee CS, Chung CH, Suh SW: Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability. Protein Sci. 1996 Nov;5(11):2236-47. [Article]
  10. Perona JJ, Tsu CA, Craik CS, Fletterick RJ: Crystal structure of an ecotin-collagenase complex suggests a model for recognition and cleavage of the collagen triple helix. Biochemistry. 1997 May 6;36(18):5381-92. [Article]
  11. Gillmor SA, Takeuchi T, Yang SQ, Craik CS, Fletterick RJ: Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases. J Mol Biol. 2000 Jun 16;299(4):993-1003. [Article]
  12. Wang SX, Esmon CT, Fletterick RJ: Crystal structure of thrombin-ecotin reveals conformational changes and extended interactions. Biochemistry. 2001 Aug 28;40(34):10038-46. [Article]
  13. McGrath ME, Gillmor SA, Fletterick RJ: Ecotin: lessons on survival in a protease-filled world. Protein Sci. 1995 Feb;4(2):141-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails