Insulin-like growth factor-binding protein 6
Details
- Name
- Insulin-like growth factor-binding protein 6
- Synonyms
- IBP-6
- IBP6
- Gene Name
- IGFBP6
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0052016|Insulin-like growth factor-binding protein 6 MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
- Number of residues
- 240
- Molecular Weight
- 25322.225
- Theoretical pI
- Not Available
- GO Classification
- Functionsfibronectin binding / insulin-like growth factor I binding / insulin-like growth factor II binding / signaling receptor bindingProcessescellular protein metabolic process / negative regulation of canonical Wnt signaling pathway / negative regulation of cell population proliferation / regulation of insulin-like growth factor receptor signaling pathway / signal transductionComponentsextracellular region / extracellular space / Golgi apparatus / insulin-like growth factor binary complex
- General Function
- IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
- Specific Function
- Fibronectin binding
- Pfam Domain Function
- Thyroglobulin_1 (PF00086)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0052017|Insulin-like growth factor-binding protein 6 (IGFBP6) ATGACCCCCCACAGGCTGCTGCCACCGCTGCTGCTGCTGCTAGCTCTGCTGCTCGCTGCC AGCCCAGGAGGCGCCTTGGCGCGGTGCCCAGGCTGCGGGCAAGGGGTGCAGGCGGGTTGT CCAGGGGGCTGCGTGGAGGAGGAGGATGGGGGGTCGCCAGCCGAGGGCTGCGCGGAAGCT GAGGGCTGTCTCAGGAGGGAGGGGCAGGAGTGCGGGGTCTACACCCCTAACTGCGCCCCA GGACTGCAGTGCCATCCGCCCAAGGACGACGAGGCGCCTTTGCGGGCGCTGCTGCTCGGC CGAGGCCGCTGCCTTCCGGCCCGCGCGCCTGCTGTTGCAGAGGAGAATCCTAAGGAGAGT AAACCCCAAGCAGGCACTGCCCGCCCACAGGATGTGAACCGCAGAGACCAACAGAGGAAT CCAGGCACCTCTACCACGCCCTCCCAGCCCAATTCTGCGGGTGTCCAAGACACTGAGATG GGCCCATGCCGTAGACATCTGGACTCAGTGCTGCAGCAACTCCAGACTGAGGTCTACCGA GGGGCTCAAACACTCTACGTGCCCAATTGTGACCATCGAGGCTTCTACCGGAAGCGGCAG TGCCGCTCCTCCCAGGGGCAGCGCCGAGGTCCCTGCTGGTGTGTGGATCGGATGGGCAAG TCCCTGCCAGGGTCTCCAGATGGCAATGGAAGCTCCTCCTGCCCCACTGGGAGTAGCGGC TAA
- Chromosome Location
- 12
- Locus
- 12q13.13
- External Identifiers
Resource Link UniProtKB ID P24592 UniProtKB Entry Name IBP6_HUMAN HGNC ID HGNC:5475 - General References
- Kiefer MC, Masiarz FR, Bauer DM, Zapf J: Identification and molecular cloning of two new 30-kDa insulin-like growth factor binding proteins isolated from adult human serum. J Biol Chem. 1991 May 15;266(14):9043-9. [Article]
- Ehrenborg E, Zazzi H, Lagercrantz S, Granqvist M, Hillerbrand U, Allander SV, Larsson C, Luthman H: Characterization and chromosomal localization of the human insulin-like growth factor-binding protein 6 gene. Mamm Genome. 1999 Apr;10(4):376-80. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Shimasaki S, Gao L, Shimonaka M, Ling N: Isolation and molecular cloning of insulin-like growth factor-binding protein-6. Mol Endocrinol. 1991 Jul;5(7):938-48. doi: 10.1210/mend-5-7-938. [Article]
- Zapf J, Kiefer M, Merryweather J, Musiarz F, Bauer D, Born W, Fischer JA, Froesch ER: Isolation from adult human serum of four insulin-like growth factor (IGF) binding proteins and molecular cloning of one of them that is increased by IGF I administration and in extrapancreatic tumor hypoglycemia. J Biol Chem. 1990 Sep 5;265(25):14892-8. [Article]
- Roghani M, Hossenlopp P, Lepage P, Balland A, Binoux M: Isolation from human cerebrospinal fluid of a new insulin-like growth factor-binding protein with a selective affinity for IGF-II. FEBS Lett. 1989 Sep 25;255(2):253-8. [Article]
- Martin JL, Willetts KE, Baxter RC: Purification and properties of a novel insulin-like growth factor-II binding protein from transformed human fibroblasts. J Biol Chem. 1990 Mar 5;265(7):4124-30. [Article]
- Andress DL, Birnbaum RS: A novel human insulin-like growth factor binding protein secreted by osteoblast-like cells. Biochem Biophys Res Commun. 1991 Apr 15;176(1):213-8. [Article]
- Neumann GM, Marinaro JA, Bach LA: Identification of O-glycosylation sites and partial characterization of carbohydrate structure and disulfide linkages of human insulin-like growth factor binding protein 6. Biochemistry. 1998 May 5;37(18):6572-85. doi: 10.1021/bi972894e. [Article]
- Neumann GM, Bach LA: The N-terminal disulfide linkages of human insulin-like growth factor-binding protein-6 (hIGFBP-6) and hIGFBP-1 are different as determined by mass spectrometry. J Biol Chem. 1999 May 21;274(21):14587-94. [Article]
- Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [Article]