2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Details
- Name
- 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
- Synonyms
- 2.7.6.3
- 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
- 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
- HPPK
- PPPK
- Gene Name
- folK
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0016432|2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK NRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
- Number of residues
- 159
- Molecular Weight
- 18078.61
- Theoretical pI
- 5.23
- GO Classification
- Functions2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity / ATP binding / kinase activity / magnesium ion bindingProcessesfolic acid biosynthetic process / tetrahydrofolate biosynthetic process
- General Function
- Magnesium ion binding
- Specific Function
- Not Available
- Pfam Domain Function
- HPPK (PF01288)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0016433|2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) ATGACAGTGGCGTATATTGCCATAGGCAGCAATCTGGCCTCTCCGCTGGAGCAGGTCAAT GCTGCCCTGAAAGCATTAGGCGATATCCCTGAAAGCCACATTCTTACCGTTTCTTCGTTT TACCGCACCCCACCGCTGGGGCCGCAAGATCAACCCGATTACTTAAACGCAGCCGTGGCG CTGGAAACCTCTCTTGCACCTGAAGAGCTACTCAATCACACACAGCGTATTGAATTGCAG CAAGGTCGCGTCCGCAAAGCTGAACGCTGGGGACCACGCACGCTGGATCTCGACATCATG CTGTTTGGTAATGAAGTGATAAATACTGAACGCCTGACCGTTCCGCACTACGATATGAAG AATCGTGGATTTATGCTGTGGCCGCTGTTTGAAATCGCGCCGGAGTTGGTGTTTCCTGAT GGGGAGATGTTGCGTCAAATCTTACATACAAGAGCATTTGACAAATTAAACAAATGGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P26281 UniProtKB Entry Name HPPK_ECOLI GenBank Protein ID 146013 GenBank Gene ID L06495 - General References
- Talarico TL, Ray PH, Dev IK, Merrill BM, Dallas WS: Cloning, sequence analysis, and overexpression of Escherichia coli folK, the gene coding for 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase. J Bacteriol. 1992 Sep;174(18):5971-7. [Article]
- Fujita N, Mori H, Yura T, Ishihama A: Systematic sequencing of the Escherichia coli genome: analysis of the 2.4-4.1 min (110,917-193,643 bp) region. Nucleic Acids Res. 1994 May 11;22(9):1637-9. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Talarico TL, Dev IK, Dallas WS, Ferone R, Ray PH: Purification and partial characterization of 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase and 7,8-dihydropteroate synthase from Escherichia coli MC4100. J Bacteriol. 1991 Nov;173(21):7029-32. [Article]
- Liu JD, Parkinson JS: Genetics and sequence analysis of the pcnB locus, an Escherichia coli gene involved in plasmid copy number control. J Bacteriol. 1989 Mar;171(3):1254-61. [Article]
- Xiao B, Shi G, Chen X, Yan H, Ji X: Crystal structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, a potential target for the development of novel antimicrobial agents. Structure. 1999 May;7(5):489-96. [Article]
- Stammers DK, Achari A, Somers DO, Bryant PK, Rosemond J, Scott DL, Champness JN: 2.0 A X-ray structure of the ternary complex of 7,8-dihydro-6-hydroxymethylpterinpyrophosphokinase from Escherichia coli with ATP and a substrate analogue. FEBS Lett. 1999 Jul 30;456(1):49-53. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB02119 6-Hydroxymethyl-7,8-Dihydropterin experimental unknown Details DB02596 alpha,beta-Methyleneadenosine 5'-triphosphate experimental unknown Details DB03197 6-Hydroxymethylpterin experimental unknown Details DB04047 6-hydroxymethylpterin diphosphate experimental unknown Details DB04158 6-(adenosine tetraphosphate-methyl)-7,8-dihydropterin experimental unknown Details DB04610 7,8-dihydro-6-hydroxymethyl-7-methyl-7-[2-phenylethyl]-pterin experimental unknown Details