Light-harvesting protein B-800/850 alpha chain

Details

Name
Light-harvesting protein B-800/850 alpha chain
Synonyms
  • Antenna pigment protein alpha chain
Gene Name
Not Available
Organism
Rhodoblastus acidophilus
Amino acid sequence
>lcl|BSEQ0017267|Light-harvesting protein B-800/850 alpha chain
MNQGKIWTVVNPAIGIPALLGSVTVIAILVHLAILSHTTWFPAYWQGGVKKAA
Number of residues
53
Molecular Weight
5653.73
Theoretical pI
10.64
GO Classification
Functions
bacteriochlorophyll binding / electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity / metal ion binding
Processes
photosynthesis, light reaction / protein-chromophore linkage
Components
integral component of membrane / organelle inner membrane / plasma membrane / plasma membrane light-harvesting complex
General Function
Metal ion binding
Specific Function
Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers.
Pfam Domain Function
Transmembrane Regions
14-34
Cellular Location
Cell inner membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP26789
UniProtKB Entry NameLHA4_RHOAC
General References
  1. Bissig I, Brunisholz RA, Suter F, Cogdell RJ, Zuber H: The complete amino acid sequences of the B800-850 antenna polypeptides from Rhodopseudomonas acidophila strain 7750. Z Naturforsch C. 1988 Jan-Feb;43(1-2):77-83. [PubMed:3376519]
  2. Freer A, Prince S, Sauer K, Papiz M, Hawthornthwaite-Lawless A, McDermott G, Cogdell R, Isaacs NW: Pigment-pigment interactions and energy transfer in the antenna complex of the photosynthetic bacterium Rhodopseudomonas acidophila. Structure. 1996 Apr 15;4(4):449-62. [PubMed:8740367]
  3. Prince SM, Papiz MZ, Freer AA, McDermott G, Hawthornthwaite-Lawless AM, Cogdell RJ, Isaacs NW: Apoprotein structure in the LH2 complex from Rhodopseudomonas acidophila strain 10050: modular assembly and protein pigment interactions. J Mol Biol. 1997 May 2;268(2):412-23. [PubMed:9159480]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02899N-CarboxymethionineexperimentalunknownDetails
DB04464N-FormylmethionineexperimentalunknownDetails
DB04147Dodecyldimethylamine N-oxideexperimentalunknownDetails