Neuromedin-K receptor

Details

Name
Neuromedin-K receptor
Synonyms
  • Neurokinin B receptor
  • NK-3 receptor
  • NK-3R
  • NK3R
  • NKR
  • TAC3R
  • Tachykinin receptor 3
Gene Name
TACR3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016769|Neuromedin-K receptor
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Number of residues
465
Molecular Weight
52201.35
Theoretical pI
9.61
GO Classification
Functions
tachykinin receptor activity
Processes
aging / hyperosmotic salinity response / positive regulation of blood pressure / positive regulation of heart rate / positive regulation of uterine smooth muscle contraction / regulation of dopamine metabolic process / regulation of feeding behavior / response to cocaine / response to estradiol / response to morphine / tachykinin receptor signaling pathway
Components
cytoplasm / dendrite membrane / integral component of plasma membrane / neuronal cell body membrane / nucleus / plasma membrane
General Function
Tachykinin receptor activity
Specific Function
This is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: neuromedin-K > substance K > substance P.
Pfam Domain Function
Transmembrane Regions
85-107 118-139 160-181 202-222 246-270 300-321 335-359
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016770|Neuromedin-K receptor (TACR3)
ATGGCCACTCTCCCAGCAGCAGAAACCTGGATAGACGGGGGTGGAGGCGTGGGTGCAGAC
GCCGTGAACCTGACCGCCTCGCTAGCTGCCGGGGCGGCCACGGGGGCAGTTGAGACTGGG
TGGCTGCAACTGCTGGACCAAGCTGGCAACCTCTCCTCCTCCCCTTCCGCGCTGGGACTG
CCTGTGGCTTCCCCCGCGCCCTCCCAGCCCTGGGCCAACCTCACCAACCAGTTCGTGCAG
CCGTCCTGGCGCATCGCGCTCTGGTCCCTGGCGTATGGTGTGGTGGTGGCAGTGGCAGTT
TTGGGAAATCTCATCGTCATCTGGATCATCCTGGCCCACAAGCGCATGAGGACTGTCACC
AACTACTTCCTTGTGAACCTGGCTTTCTCCGACGCCTCCATGGCCGCCTTCAACACGTTG
GTCAATTTCATCTACGCGCTTCATAGCGAGTGGTACTTTGGCGCCAACTACTGCCGCTTC
CAGAACTTCTTTCCTATCACAGCTGTGTTCGCCAGCATCTACTCCATGACGGCCATTGCG
GTGGACAGGTATATGGCTATTATTGATCCCTTGAAACCCAGACTGTCTGCTACAGCAACC
AAGATTGTCATTGGAAGTATTTGGATTCTAGCATTTCTACTTGCCTTCCCTCAGTGTCTT
TATTCCAAAACCAAAGTCATGCCAGGCCGTACTCTCTGCTTTGTGCAATGGCCAGAAGGT
CCCAAACAACATTTCACTTACCATATTATCGTCATTATACTGGTGTACTGTTTCCCATTG
CTCATCATGGGTATTACATACACCATTGTTGGAATTACTCTCTGGGGAGGAGAAATCCCA
GGAGATACCTGTGACAAGTATCATGAGCAGCTAAAGGCCAAAAGAAAGGTTGTCAAAATG
ATGATTATTGTTGTCATGACATTTGCTATCTGCTGGCTGCCCTATCATATTTACTTCATT
CTCACTGCAATCTATCAACAACTAAATAGATGGAAATACATCCAGCAGGTCTACCTGGCT
AGCTTTTGGCTGGCAATGAGCTCAACCATGTACAATCCCATCATCTACTGCTGTCTGAAT
AAAAGATTTCGAGCTGGCTTCAAGAGAGCATTTCGCTGGTGTCCTTTCATCAAAGTTTCC
AGCTATGATGAGCTAGAGCTCAAGACCACCAGGTTTCATCCAAACCGGCAAAGCAGTATG
TACACCGTGACCAGAATGGAGTCCATGACAGTCGTGTTTGACCCCAACGATGCAGACACC
ACCAGGTCCAGTCGGAAGAAAAGAGCAACGCCAAGAGACCCAAGTTTCAATGGCTGCTCT
CGCAGGAATTCCAAATCTGCCTCCGCCACTTCAAGTTTCATAAGCTCACCCTATACCTCT
GTGGATGAATATTCTTAA
Chromosome Location
4
Locus
4q25
External Identifiers
ResourceLink
UniProtKB IDP29371
UniProtKB Entry NameNK3R_HUMAN
GenBank Gene IDM89473
GenAtlas IDTACR3
HGNC IDHGNC:11528
General References
  1. Huang RR, Cheung AH, Mazina KE, Strader CD, Fong TM: cDNA sequence and heterologous expression of the human neurokinin-3 receptor. Biochem Biophys Res Commun. 1992 Apr 30;184(2):966-72. [Article]
  2. Buell G, Schulz MF, Arkinstall SJ, Maury K, Missotten M, Adami N, Talabot F, Kawashima E: Molecular characterisation, expression and localisation of human neurokinin-3 receptor. FEBS Lett. 1992 Mar 24;299(1):90-5. [Article]
  3. Takahashi K, Tanaka A, Hara M, Nakanishi S: The primary structure and gene organization of human substance P and neuromedin K receptors. Eur J Biochem. 1992 Mar 15;204(3):1025-33. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Topaloglu AK, Reimann F, Guclu M, Yalin AS, Kotan LD, Porter KM, Serin A, Mungan NO, Cook JR, Ozbek MN, Imamoglu S, Akalin NS, Yuksel B, O'Rahilly S, Semple RK: TAC3 and TACR3 mutations in familial hypogonadotropic hypogonadism reveal a key role for Neurokinin B in the central control of reproduction. Nat Genet. 2009 Mar;41(3):354-8. doi: 10.1038/ng.306. Epub 2008 Dec 11. [Article]
  6. Miraoui H, Dwyer AA, Sykiotis GP, Plummer L, Chung W, Feng B, Beenken A, Clarke J, Pers TH, Dworzynski P, Keefe K, Niedziela M, Raivio T, Crowley WF Jr, Seminara SB, Quinton R, Hughes VA, Kumanov P, Young J, Yialamas MA, Hall JE, Van Vliet G, Chanoine JP, Rubenstein J, Mohammadi M, Tsai PS, Sidis Y, Lage K, Pitteloud N: Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism. Am J Hum Genet. 2013 May 2;92(5):725-43. doi: 10.1016/j.ajhg.2013.04.008. [Article]
  7. Marcos S, Sarfati J, Leroy C, Fouveaut C, Parent P, Metz C, Wolczynski S, Gerard M, Bieth E, Kurtz F, Verier-Mine O, Perrin L, Archambeaud F, Cabrol S, Rodien P, Hove H, Prescott T, Lacombe D, Christin-Maitre S, Touraine P, Hieronimus S, Dewailly D, Young J, Pugeat M, Hardelin JP, Dode C: The prevalence of CHD7 missense versus truncating mutations is higher in patients with Kallmann syndrome than in typical CHARGE patients. J Clin Endocrinol Metab. 2014 Oct;99(10):E2138-43. doi: 10.1210/jc.2014-2110. Epub 2014 Jul 31. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04872OsanetantinvestigationalunknownDetails
DB06429TalnetantinvestigationalyesantagonistDetails
DB11692PavinetantinvestigationalyesantagonistDetails