Non-receptor tyrosine-protein kinase TYK2

Details

Name
Non-receptor tyrosine-protein kinase TYK2
Synonyms
  • 2.7.10.2
Gene Name
TYK2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012887|Non-receptor tyrosine-protein kinase TYK2
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
Number of residues
1187
Molecular Weight
133648.77
Theoretical pI
7.15
GO Classification
Functions
ATP binding / growth hormone receptor binding / non-membrane spanning protein tyrosine kinase activity / protein tyrosine kinase activity
Processes
cell differentiation / cell migration / cytokine-mediated signaling pathway / innate immune response / intracellular signal transduction / peptidyl-tyrosine autophosphorylation / protein phosphorylation / regulation of cell proliferation / regulation of type I interferon-mediated signaling pathway / transmembrane receptor protein tyrosine kinase signaling pathway / type I interferon signaling pathway
Components
cytoplasm / cytoskeleton / cytosol / extracellular exosome / extrinsic component of cytoplasmic side of plasma membrane / nucleus
General Function
Protein tyrosine kinase activity
Specific Function
Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012888|Non-receptor tyrosine-protein kinase TYK2 (TYK2)
ATGCCTCTGCGCCACTGGGGGATGGCCAGGGGCAGTAAGCCCGTTGGGGATGGAGCCCAG
CCCATGGCTGCCATGGGAGGCCTGAAGGTGCTTCTGCACTGGGCTGGTCCAGGCGGCGGG
GAGCCCTGGGTCACTTTCAGTGAGTCATCGCTGACAGCTGAGGAAGTCTGCATCCACATT
GCACATAAAGTTGGTATCACTCCTCCTTGCTTCAATCTCTTTGCCCTCTTCGATGCTCAG
GCCCAAGTCTGGTTGCCCCCAAACCACATCCTAGAGATCCCCAGAGATGCAAGCCTGATG
CTATATTTCCGCATAAGGTTTTATTTCCGGAACTGGCATGGCATGAATCCTCGGGAACCG
GCTGTGTACCGTTGTGGGCCCCCAGGAACCGAGGCATCCTCAGATCAGACAGCACAGGGG
ATGCAACTCCTGGACCCAGCCTCATTTGAGTACCTCTTTGAGCAGGGCAAGCATGAGTTT
GTGAATGACGTGGCATCACTGTGGGAGCTGTCGACCGAGGAGGAGATCCACCACTTTAAG
AATGAGAGCCTGGGCATGGCCTTTCTGCACCTCTGTCACCTCGCTCTCCGCCATGGCATC
CCCCTGGAGGAGGTGGCCAAGAAGACCAGCTTCAAGGACTGCATCCCGCGCTCCTTCCGC
CGGCATATCCGGCAGCACAGCGCCCTGACCCGGCTGCGCCTTCGGAACGTCTTCCGCAGG
TTCCTGCGGGACTTCCAGCCGGGCCGACTCTCCCAGCAGATGGTCATGGTCAAATACCTA
GCCACACTCGAGCGGCTGGCACCCCGCTTCGGCACAGAGCGTGTGCCCGTGTGCCACCTG
AGGCTGCTGGCCCAGGCCGAGGGGGAGCCCTGCTACATCCGGGACAGTGGGGTGGCCCCT
ACAGACCCTGGCCCTGAGTCTGCTGCTGGGCCCCCAACCCACGAGGTGCTGGTGACAGGC
ACTGGTGGCATCCAGTGGTGGCCAGTAGAGGAGGAGGTGAACAAGGAGGAGGGTTCTAGT
GGCAGCAGTGGCAGGAACCCCCAAGCCAGCCTGTTTGGGAAGAAGGCCAAGGCTCACAAG
GCAGTCGGCCAGCCGGCAGACAGGCCGCGGGAGCCACTGTGGGCCTACTTCTGTGACTTC
CGGGACATCACCCACGTGGTGCTGAAAGAGCACTGTGTCAGCATCCACCGGCAGGACAAC
AAGTGCCTGGAGCTGAGCTTGCCTTCCCGGGCTGCGGCGCTGTCCTTCGTGTCGCTGGTG
GACGGCTATTTCCGCCTGACGGCCGACTCCAGCCACTACCTGTGCCACGAGGTGGCTCCC
CCACGGCTGGTGATGAGCATCCGGGATGGGATCCACGGACCCCTGCTGGAGCCATTTGTG
CAGGCCAAGCTGCGGCCCGAGGACGGCCTGTACCTCATTCACTGGAGCACCAGCCACCCC
TACCGCCTGATCCTCACAGTGGCCCAGCGTAGCCAGGCACCAGACGGCATGCAGAGCTTG
CGGCTCCGAAAGTTCCCCATTGAGCAGCAGGACGGGGCCTTCGTGCTGGAGGGCTGGGGC
CGGTCCTTCCCCAGCGTTCGGGAACTTGGGGCTGCCTTGCAGGGCTGCTTGCTGAGGGCC
GGGGATGACTGCTTCTCTCTGCGTCGCTGTTGCCTGCCCCAACCAGGAGAAACCTCCAAT
CTCATCATCATGCGGGGGGCTCGGGCCAGCCCCAGGACACTCAACCTCAGCCAGCTCAGC
TTCCACCGGGTTGACCAGAAGGAGATCACCCAGCTGTCCCACTTGGGCCAGGGCACAAGG
ACCAACGTGTATGAGGGCCGCCTGCGAGTGGAGGGCAGCGGGGACCCTGAGGAGGGCAAG
ATGGATGACGAGGACCCCCTCGTGCCTGGCAGGGACCGTGGGCAGGAGCTACGAGTGGTG
CTCAAAGTGCTGGACCCTAGTCACCATGACATCGCCCTGGCCTTCTACGAGACAGCCAGC
CTCATGAGCCAGGTCTCCCACACGCACCTGGCCTTCGTGCATGGCGTCTGTGTGCGCGGC
CCTGAAAATATCATGGTGACAGAGTACGTGGAGCACGGACCCCTGGATGTGTGGCTGCGG
AGGGAGCGGGGCCATGTGCCCATGGCTTGGAAGATGGTGGTGGCCCAGCAGCTGGCCAGC
GCCCTCAGCTACCTGGAGAACAAGAACCTGGTTCATGGTAATGTGTGTGGCCGGAACATC
CTGCTGGCCCGGCTGGGGTTGGCAGAGGGCACCAGCCCCTTCATCAAGCTGAGTGATCCT
GGCGTGGGCCTGGGCGCCCTCTCCAGGGAGGAGCGGGTGGAGAGGATCCCCTGGCTGGCC
CCCGAATGCCTACCAGGTGGGGCCAACAGCCTAAGCACCGCCATGGACAAGTGGGGGTTT
GGCGCCACCCTCCTGGAGATCTGCTTTGACGGAGAGGCCCCTCTGCAGAGCCGCAGTCCC
TCCGAGAAGGAGCATTTCTACCAGAGGCAGCACCGGCTGCCCGAGCCCTCCTGCCCACAG
CTGGCCACACTCACCAGCCAGTGTCTGACCTATGAGCCAACCCAGAGGCCATCATTCCGC
ACCATCCTGCGTGACCTCACCCGGCTGCAGCCCCACAATCTTGCTGACGTCTTGACTGTG
AACCCGGACTCACCGGCGTCGGACCCTACGGTTTTCCACAAGCGCTATTTGAAAAAGATC
CGAGATCTGGGCGAGGGTCACTTCGGCAAGGTCAGCTTGTACTGCTACGATCCGACCAAC
GACGGCACTGGCGAGATGGTGGCGGTGAAAGCCCTCAAGGCAGACTGCGGCCCCCAGCAC
CGCTCGGGCTGGAAGCAGGAGATTGACATTCTGCGCACGCTCTACCACGAGCACATCATC
AAGTACAAGGGCTGCTGCGAGGACCAAGGCGAGAAGTCGCTGCAGCTGGTCATGGAGTAC
GTGCCCCTGGGCAGCCTCCGAGACTACCTGCCCCGGCACAGCATCGGGCTGGCCCAGCTG
CTGCTCTTCGCCCAGCAGATCTGCGAGGGCATGGCCTATCTGCACGCGCAGCACTACATC
CACCGAGACCTAGCCGCGCGCAACGTGCTGCTGGACAACGACAGGCTGGTCAAGATCGGG
GACTTTGGCCTAGCCAAGGCCGTGCCCGAAGGCCACGAGTACTACCGCGTGCGCGAGGAT
GGGGACAGCCCCGTGTTCTGGTATGCCCCAGAGTGCCTGAAGGAGTATAAGTTCTACTAT
GCGTCAGATGTCTGGTCCTTCGGGGTGACCCTGTATGAGCTGCTGACGCACTGTGACTCC
AGCCAGAGCCCCCCCACGAAATTCCTTGAGCTCATAGGCATTGCTCAGGGTCAGATGACA
GTTCTGAGACTCACTGAGTTGCTGGAACGAGGGGAGAGGCTGCCACGGCCCGACAAATGT
CCCTGTGAGGTCTATCATCTCATGAAGAACTGCTGGGAGACAGAGGCGTCCTTTCGCCCA
ACCTTCGAGAACCTCATACCCATTCTGAAGACAGTCCATGAGAAGTACCAAGGCCAGGCC
CCTTCAGTGTTCAGCGTGTGCTGA
Chromosome Location
19
Locus
19p13.2
External Identifiers
ResourceLink
UniProtKB IDP29597
UniProtKB Entry NameTYK2_HUMAN
GenBank Protein ID37504
GenBank Gene IDX54637
HGNC IDHGNC:12440
General References
  1. Firmbach-Kraft I, Byers M, Shows T, Dalla-Favera R, Krolewski JJ: tyk2, prototype of a novel class of non-receptor tyrosine kinase genes. Oncogene. 1990 Sep;5(9):1329-36. [Article]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  3. Velazquez L, Fellous M, Stark GR, Pellegrini S: A protein tyrosine kinase in the interferon alpha/beta signaling pathway. Cell. 1992 Jul 24;70(2):313-22. [Article]
  4. Krolewski JJ, Lee R, Eddy R, Shows TB, Dalla-Favera R: Identification and chromosomal mapping of new human tyrosine kinase genes. Oncogene. 1990 Mar;5(3):277-82. [Article]
  5. Partanen J, Makela TP, Alitalo R, Lehvaslaiho H, Alitalo K: Putative tyrosine kinases expressed in K-562 human leukemia cells. Proc Natl Acad Sci U S A. 1990 Nov;87(22):8913-7. [Article]
  6. Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J: Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase. Mol Cell Biol. 1994 Dec;14(12):8133-42. [Article]
  7. Steindler C, Li Z, Algarte M, Alcover A, Libri V, Ragimbeau J, Pellegrini S: Jamip1 (marlin-1) defines a family of proteins interacting with janus kinases and microtubules. J Biol Chem. 2004 Oct 8;279(41):43168-77. Epub 2004 Jul 23. [Article]
  8. Minegishi Y, Saito M, Morio T, Watanabe K, Agematsu K, Tsuchiya S, Takada H, Hara T, Kawamura N, Ariga T, Kaneko H, Kondo N, Tsuge I, Yachie A, Sakiyama Y, Iwata T, Bessho F, Ohishi T, Joh K, Imai K, Kogawa K, Shinohara M, Fujieda M, Wakiguchi H, Pasic S, Abinun M, Ochs HD, Renner ED, Jansson A, Belohradsky BH, Metin A, Shimizu N, Mizutani S, Miyawaki T, Nonoyama S, Karasuyama H: Human tyrosine kinase 2 deficiency reveals its requisite roles in multiple cytokine signals involved in innate and acquired immunity. Immunity. 2006 Nov;25(5):745-55. [Article]
  9. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [Article]
  10. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [Article]
  11. Chrencik JE, Patny A, Leung IK, Korniski B, Emmons TL, Hall T, Weinberg RA, Gormley JA, Williams JM, Day JE, Hirsch JL, Kiefer JR, Leone JW, Fischer HD, Sommers CD, Huang HC, Jacobsen EJ, Tenbrink RE, Tomasselli AG, Benson TE: Structural and thermodynamic characterization of the TYK2 and JAK3 kinase domains in complex with CP-690550 and CMP-6. J Mol Biol. 2010 Jul 16;400(3):413-33. doi: 10.1016/j.jmb.2010.05.020. Epub 2010 May 15. [Article]
  12. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB047162-tert-butyl-9-fluoro-1,6-dihydrobenzo[h]imidazo[4,5-f]isoquinolin-7-oneexperimentalunknownDetails
DB08895Tofacitinibapproved, investigationalunknownDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails
DB08877RuxolitinibapprovedyesinhibitorDetails