High affinity immunoglobulin epsilon receptor subunit gamma

Details

Name
High affinity immunoglobulin epsilon receptor subunit gamma
Synonyms
  • Fc receptor gamma-chain
  • Fc-epsilon RI-gamma
  • FceRI gamma
  • FcRgamma
  • IgE Fc receptor subunit gamma
Gene Name
FCER1G
Organism
Humans
Amino acid sequence
>lcl|BSEQ0020446|High affinity immunoglobulin epsilon receptor subunit gamma
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ
Number of residues
86
Molecular Weight
9667.355
Theoretical pI
7.24
GO Classification
Functions
IgE binding / IgE receptor activity / IgG binding
Processes
antigen processing and presentation of exogenous peptide antigen via MHC class I / antigen processing and presentation of exogenous peptide antigen via MHC class II / blood coagulation / cellular response to low-density lipoprotein particle stimulus / defense response to bacterium / Fc receptor mediated stimulatory signaling pathway / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway / immunoglobulin mediated immune response / innate immune response / integrin-mediated signaling pathway / leukocyte migration / mast cell activation / negative regulation of mast cell apoptotic process / neutrophil activation involved in immune response / neutrophil chemotaxis / phagocytosis, engulfment / platelet activation / positive regulation of interleukin-10 production / positive regulation of interleukin-6 production / positive regulation of mast cell cytokine production / positive regulation of mast cell degranulation / positive regulation of phagocytosis / positive regulation of tumor necrosis factor production / positive regulation of type I hypersensitivity / positive regulation of type IIa hypersensitivity / positive regulation of type III hypersensitivity / protein localization to plasma membrane / receptor internalization / regulation of platelet activation / serotonin secretion by platelet / stimulatory C-type lectin receptor signaling pathway / T cell differentiation involved in immune response
Components
cell surface / external side of plasma membrane / Fc-epsilon receptor I complex / integral component of plasma membrane / plasma membrane
General Function
Igg binding
Specific Function
Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Pfam Domain Function
Transmembrane Regions
24-44
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0020447|High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G)
ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGA
GAGCCTCAGCTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACC
CTCCTCTACTGTCGACTGAAGATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAA
TCAGATGGTGTTTACACGGGCCTGAGCACCAGGAACCAGGAGACTTACGAGACTCTGAAG
CATGAGAAACCACCACAGTAG
Chromosome Location
1
Locus
1q23
External Identifiers
ResourceLink
UniProtKB IDP30273
UniProtKB Entry NameFCERG_HUMAN
GenBank Protein ID182488
GenBank Gene IDM33195
GenAtlas IDFCER1G
HGNC IDHGNC:3611
General References
  1. Kuster H, Thompson H, Kinet JP: Characterization and expression of the gene for the human Fc receptor gamma subunit. Definition of a new gene family. J Biol Chem. 1990 Apr 15;265(11):6448-52. [Article]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
  3. van Vugt MJ, Heijnen AF, Capel PJ, Park SY, Ra C, Saito T, Verbeek JS, van de Winkel JG: FcR gamma-chain is essential for both surface expression and function of human Fc gamma RI (CD64) in vivo. Blood. 1996 May 1;87(9):3593-9. [Article]
  4. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [Article]
  5. Yamasaki S, Ishikawa E, Sakuma M, Hara H, Ogata K, Saito T: Mincle is an ITAM-coupled activating receptor that senses damaged cells. Nat Immunol. 2008 Oct;9(10):1179-88. doi: 10.1038/ni.1651. Epub 2008 Sep 7. [Article]
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  7. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00895Benzylpenicilloyl polylysineapprovedyesagonistDetails