Guanylate cyclase soluble subunit alpha-2

Details

Name
Guanylate cyclase soluble subunit alpha-2
Synonyms
  • 4.6.1.2
  • GCS-alpha-2
  • GUC1A2
  • GUCSA2
Gene Name
GUCY1A2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006890|Guanylate cyclase soluble subunit alpha-2
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLEPSPAAAAAAAAPA
PTPAASAAAAAATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQV
IGYRDAEKNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEFFNI
CFHENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLMLHYF
HPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNCSCLTFLIKECENTN
IMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQLRCDTHKVLKF
EDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSIL
FLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTH
QALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPM
QVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELS
EEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSP
TTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKVSY
NIGTMFLRETSL
Number of residues
732
Molecular Weight
81749.185
Theoretical pI
7.72
GO Classification
Functions
GTP binding / guanylate cyclase activity / heme binding
Processes
blood coagulation / cGMP biosynthetic process / intracellular signal transduction / positive regulation of cGMP biosynthetic process / signal transduction
Components
guanylate cyclase complex, soluble / plasma membrane
General Function
Heme binding
Specific Function
Has guanylyl cyclase on binding to the beta-1 subunit.Isoform 2 acts as a negative regulator of guanylyl cyclase activity as it forms non-functional heterodimers with the beta subunits.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0012487|Guanylate cyclase soluble subunit alpha-2 (GUCY1A2)
ATGTCTCGAAGGAAGATTTCGTCCGAGTCCTTCAGCTCCCTGGGCTCCGACTACCTGGAG
ACCAGCCCGGAGGAGGAGGGGGAGTGCCCCCTGTCTAGGCTCTGCTGGAATGGCAGCCGG
AGCCCGCCCGGGCCGCTGGAGCCCAGCCCGGCCGCAGCTGCCGCTGCCGCCGCCCCGGCC
CCGACCCCGGCTGCTTCTGCCGCCGCCGCCGCTGCCACTGCCGGGGCCAGGAGGGTGCAG
CGCCGGAGGCGGGTCAACCTGGACTCGCTGGGCGAGAGCATCAGCCGCCTGACGGCGCCC
TCGCCTCAGACGATACAGCAGACTCTCAAGAGGACACTGCAGTATTATGAACATCAAGTT
ATTGGTTACAGGGATGCAGAAAAGAATTTCCACAATATCTCTAACAGATGCTCCTATGCA
GACCACTCCAACAAAGAAGAAATTGAAGATGTCTCAGGAATTCTTCAGTGTACTGCTAAT
ATACTCGGTTTGAAGTTTGAGGAAATTCAAAAAAGATTTGGTGAAGAGTTCTTTAATATA
TGCTTTCATGAGAATGAGAGAGTCCTTCGAGCTGTAGGTGGCACTTTGCAGGACTTTTTT
AACGGCTTTGATGCTTTGTTGGAACACATTAGAACTTCTTTTGGAAAACAGGCCACTCTG
GAGTCACCATCTTTCCTATGCAAAGAGCTCCCTGAAGGTACTCTCATGCTCCACTACTTC
CACCCTCACCATATTGTGGGGTTTGCAATGCTGGGGATGATTAAGGCTGCAGGAAAGAAG
ATCTATCGGCTGGATGTGGAAGTGGAACAGGTTGCAAATGAGAAGCTATGCTCTGATGTT
TCAAACCCAGGCAATTGTAGCTGTCTTACTTTCCTTATCAAAGAATGTGAAAATACTAAT
ATCATGAAGAACCTTCCACAGGGAACCTCCCAAGTTCCTGCGGACCTCAGAATTAGCATC
AACACCTTCTGTAGAGCCTTCCCTTTCCACTTGATGTTTGATCCCAGCATGTCAGTCCTT
CAGTTGGGGGAAGGTCTAAGGAAGCAGCTTCGATGTGACACTCACAAAGTGCTCAAGTTT
GAGGACTGCTTCGAGATTGTATCTCCAAAGGTTAATGCCACCTTTGAAAGGGTCCTGCTG
CGACTGTCTACCCCGTTTGTGATTAGAACCAAGCCTGAGGCTTCTGGCTCTGAAAATAAA
GACAAGGTGATGGAAGTCAAAGGACAAATGATCCATGTTCCAGAATCAAATTCCATTTTA
TTTTTGGGCTCTCCATGTGTGGACAAGTTGGATGAACTCATGGGCCGAGGGCTACATCTC
TCAGACATCCCTATCCATGATGCCACCCGAGATGTCATTTTGGTTGGTGAGCAGGCAAAG
GCCCAAGATGGGTTGAAGAAAAGGATGGATAAATTAAAGGCAACTTTAGAAAGAACTCAC
CAGGCCCTGGAAGAAGAGAAAAAGAAGACAGTGGATCTTCTATATTCTATTTTCCCTGGT
GATGTAGCCCAGCAATTATGGCAAGGGCAGCAAGTACAGGCCAGAAAGTTTGATGATGTC
ACCATGCTCTTTTCAGACATTGTTGGCTTCACAGCCATATGTGCCCAGTGTACTCCCATG
CAAGTAATCAGCATGCTGAATGAACTGTACACCAGATTTGACCACCAGTGTGGATTTTTG
GATATTTATAAGGTGGAAACAATAGGTGATGCCTACTGTGTTGCAGCAGGGCTCCACAGA
AAAAGCCTCTGCCATGCTAAACCCATTGCTCTGATGGCCTTGAAGATGATGGAACTTTCA
GAAGAGGTGCTGACACCTGATGGAAGACCGATTCAGATGAGGATAGGAATTCACTCAGGC
TCCGTGCTGGCTGGAGTTGTTGGGGTGCGAATGCCACGTTATTGCCTGTTTGGAAATAAT
GTCACACTGGCAAGCAAATTCGAGTCGGGAAGTCACCCTCGGCGCATCAATGTCAGCCCA
ACCACTTACCAATTATTAAAACGAGAAGAAAGTTTCACATTCATTCCGCGGTCTCGTGAA
GAGCTTCCAGACAACTTTCCAAAGGAAATTCCTGGGATCTGCTATTTCCTGGAGGTAAGG
ACTGGTCCAAAGCCACCAAAGCCTTCTCTTTCTTCGTCGAGAATAAAAAAGGTTTCCTAC
AACATCGGCACCATGTTCCTCCGGGAGACAAGCCTCTGA
Chromosome Location
11
Locus
11q21-q22
External Identifiers
ResourceLink
UniProtKB IDP33402
UniProtKB Entry NameGCYA2_HUMAN
GenBank Protein ID31671
GenBank Gene IDX63282
HGNC IDHGNC:4684
General References
  1. Harteneck C, Wedel B, Koesling D, Malkewitz J, Bohme E, Schultz G: Molecular cloning and expression of a new alpha-subunit of soluble guanylyl cyclase. Interchangeability of the alpha-subunits of the enzyme. FEBS Lett. 1991 Nov 4;292(1-2):217-22. [Article]
  2. Behrends S, Harteneck C, Schultz G, Koesling D: A variant of the alpha 2 subunit of soluble guanylyl cyclase contains an insert homologous to a region within adenylyl cyclases and functions as a dominant negative protein. J Biol Chem. 1995 Sep 8;270(36):21109-13. [Article]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00435Nitric OxideapprovedyesinducerDetails
DB01020Isosorbide mononitrateapprovedyesactivatorDetails
DB08931RiociguatapprovedyesagoniststimulatorDetails
DB13170Plecanatideapproved, investigationalyesagonistDetails
DB09241Methylene blueapproved, investigationalyesinhibitorDetails
DB09282Molsidomineapproved, investigationalunknownagonistDetails
DB09282Molsidomineapproved, investigationalunknowninducerDetails
DB06154Pentaerythritol tetranitrateapprovedyesinducerDetails
DB13749Magnesium gluconateapproved, investigationalyessubstrateDetails
DB09401Isosorbideapproved, investigationalyesactivatorDetails