Profilin-2

Details

Name
Profilin-2
Synonyms
  • Profilin II
Gene Name
PFN2
UniProtKB Entry
P35080Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0008166|Profilin-2
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
Number of residues
140
Molecular Weight
15046.155
Theoretical pI
7.04
GO Classification
Functions
actin binding / ATP hydrolysis activity
Processes
modification of postsynaptic actin cytoskeleton / positive regulation of ATP-dependent activity / presynaptic modulation of chemical synaptic transmission / regulation of actin filament polymerization
Components
glutamatergic synapse / postsynapse / presynapse / Schaffer collateral - CA1 synapse
General Function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG
Specific Function
Actin binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm, cytoskeleton
Gene sequence
>lcl|BSEQ0012996|Profilin-2 (PFN2)
ATGGCCGGTTGGCAGAGCTACGTGGATAACCTGATGTGCGATGGCTGCTGCCAGGAGGCC
GCCATTGTCGGCTACTGCGACGCCAAATACGTCTGGGCAGCCACGGCCGGGGGCGTCTTT
CAGAGCATTACGCCAATAGAAATAGATATGATTGTAGGAAAAGACCGGGAAGGTTTCTTT
ACCAACGGTTTGACTCTTGGCGCGAAGAAATGCTCAGTGATCAGAGATAGTCTATACGTC
GATGGTGACTGCACAATGGACATCCGGACAAAGAGTCAAGGTGGGGAGCCAACATACAAT
GTGGCTGTCGGCAGAGCTGGTAGAGCATTGGTTATAGTCATGGGAAAGGAAGGTGTCCAC
GGAGGCACACTTAACAAGAAAGCATATGAACTCGCTTTATACCTGAGGAGGTCTGATGTG
TAA
Chromosome Location
3
Locus
3q25.1
External Identifiers
ResourceLink
UniProtKB IDP35080
UniProtKB Entry NamePROF2_HUMAN
GenBank Protein ID190388
GenBank Gene IDL10678
GeneCard IDPFN2
HGNC IDHGNC:8882
PDB ID(s)1D1J
KEGG IDhsa:5217
NCBI Gene ID5217
General References
  1. Honore B, Madsen P, Andersen AH, Leffers H: Cloning and expression of a novel human profilin variant, profilin II. FEBS Lett. 1993 Sep 13;330(2):151-5. [Article]
  2. Lambrechts A, Braun A, Jonckheere V, Aszodi A, Lanier LM, Robbens J, Van Colen I, Vandekerckhove J, Fassler R, Ampe C: Profilin II is alternatively spliced, resulting in profilin isoforms that are differentially expressed and have distinct biochemical properties. Mol Cell Biol. 2000 Nov;20(21):8209-19. [Article]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Gieselmann R, Kwiatkowski DJ, Janmey PA, Witke W: Distinct biochemical characteristics of the two human profilin isoforms. Eur J Biochem. 1995 May 1;229(3):621-8. [Article]
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  7. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. [Article]
  8. Nodelman IM, Bowman GD, Lindberg U, Schutt CE: X-ray structure determination of human profilin II: A comparative structural analysis of human profilins. J Mol Biol. 1999 Dec 17;294(5):1271-85. [Article]

Associated Data

Bio-Entities
Bio-EntityType
Profilin-2 (Humans)protein
primary
Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
TriglymeexperimentalunknowntargetDetails
PentaglymeexperimentalunknowntargetDetails