ADP-ribosylation factor-like protein 2

Details

Name
ADP-ribosylation factor-like protein 2
Synonyms
Not Available
Gene Name
ARL2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0052004|ADP-ribosylation factor-like protein 2
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF
KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
LIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI
FTAD
Number of residues
184
Molecular Weight
20877.765
Theoretical pI
Not Available
GO Classification
Functions
GTP binding / GTPase activity / GTPase inhibitor activity
Processes
bicellular tight junction assembly / centrosome cycle / maintenance of protein location in nucleus / negative regulation of GTPase activity / positive regulation of cell-substrate adhesion / positive regulation of microtubule polymerization / regulation of insulin secretion / regulation of microtubule polymerization / tubulin complex assembly
Components
centrosome / cytosol / focal adhesion / Golgi apparatus / lateral plasma membrane / mitochondrial intermembrane space / mitochondrial matrix / nucleolus / nucleus
General Function
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle.
Specific Function
Gtp binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Mitochondrion intermembrane space
Gene sequence
>lcl|BSEQ0052005|ADP-ribosylation factor-like protein 2 (ARL2)
ATGGGGCTCCTGACCATTCTGAAGAAGATGAAGCAGAAAGAGCGGGAGCTGCGACTGCTC
ATGCTTGGCCTGGACAATGCTGGAAAGACAACCATCCTGAAGAAGTTCAATGGGGAGGAC
ATCGACACCATCTCCCCAACGCTGGGCTTCAACATCAAGACCCTGGAGCACCGAGGATTC
AAGCTGAACATCTGGGATGTGGGTGGCCAGAAGTCCCTGCGGTCCTACTGGCGGAACTAC
TTTGAGAGCACCGATGGCCTCATCTGGGTAGTGGACAGCGCAGACCGCCAGCGCATGCAG
GACTGCCAGCGGGAGCTCCAGAGCCTGCTGGTGGAGGAGCGCCTGGCCGGAGCAACCCTC
CTCATCTTTGCTAATAAGCAGGACCTGCCTGGAGCACTGTCCTCTAACGCCATCCGCGAG
GTCCTGGAGCTGGACTCCATCCGCAGCCACCACTGGTGCATCCAGGGCTGCAGCGCCGTC
ACCGGGGAGAACCTGCTGCCGGGCATCGACTGGCTCCTGGATGACATTTCCAGCCGCATT
TTCACAGCTGACTGA
Chromosome Location
11
Locus
11q13.1
External Identifiers
ResourceLink
UniProtKB IDP36404
UniProtKB Entry NameARL2_HUMAN
HGNC IDHGNC:693
General References
  1. Clark J, Moore L, Krasinskas A, Way J, Battey J, Tamkun J, Kahn RA: Selective amplification of additional members of the ADP-ribosylation factor (ARF) family: cloning of additional human and Drosophila ARF-like genes. Proc Natl Acad Sci U S A. 1993 Oct 1;90(19):8952-6. [Article]
  2. Brandenberger R, Wei H, Zhang S, Lei S, Murage J, Fisk GJ, Li Y, Xu C, Fang R, Guegler K, Rao MS, Mandalam R, Lebkowski J, Stanton LW: Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation. Nat Biotechnol. 2004 Jun;22(6):707-16. Epub 2004 May 16. [Article]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Sharer JD, Kahn RA: The ARF-like 2 (ARL2)-binding protein, BART. Purification, cloning, and initial characterization. J Biol Chem. 1999 Sep 24;274(39):27553-61. [Article]
  6. Bhamidipati A, Lewis SA, Cowan NJ: ADP ribosylation factor-like protein 2 (Arl2) regulates the interaction of tubulin-folding cofactor D with native tubulin. J Cell Biol. 2000 May 29;149(5):1087-96. [Article]
  7. Van Valkenburgh H, Shern JF, Sharer JD, Zhu X, Kahn RA: ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins. J Biol Chem. 2001 Jun 22;276(25):22826-37. Epub 2001 Apr 12. [Article]
  8. Bartolini F, Bhamidipati A, Thomas S, Schwahn U, Lewis SA, Cowan NJ: Functional overlap between retinitis pigmentosa 2 protein and the tubulin-specific chaperone cofactor C. J Biol Chem. 2002 Apr 26;277(17):14629-34. Epub 2002 Feb 14. [Article]
  9. Sharer JD, Shern JF, Van Valkenburgh H, Wallace DC, Kahn RA: ARL2 and BART enter mitochondria and bind the adenine nucleotide transporter. Mol Biol Cell. 2002 Jan;13(1):71-83. doi: 10.1091/mbc.01-05-0245. [Article]
  10. Zhou C, Cunningham L, Marcus AI, Li Y, Kahn RA: Arl2 and Arl3 regulate different microtubule-dependent processes. Mol Biol Cell. 2006 May;17(5):2476-87. Epub 2006 Mar 8. [Article]
  11. Bowzard JB, Cheng D, Peng J, Kahn RA: ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs. J Biol Chem. 2007 Jun 15;282(24):17568-80. doi: 10.1074/jbc.M701347200. Epub 2007 Apr 23. [Article]
  12. Veltel S, Kravchenko A, Ismail S, Wittinghofer A: Specificity of Arl2/Arl3 signaling is mediated by a ternary Arl3-effector-GAP complex. FEBS Lett. 2008 Jul 23;582(17):2501-7. doi: 10.1016/j.febslet.2008.05.053. Epub 2008 Jun 25. [Article]
  13. Muromoto R, Sekine Y, Imoto S, Ikeda O, Okayama T, Sato N, Matsuda T: BART is essential for nuclear retention of STAT3. Int Immunol. 2008 Mar;20(3):395-403. doi: 10.1093/intimm/dxm154. Epub 2008 Jan 29. [Article]
  14. Bailey LK, Campbell LJ, Evetts KA, Littlefield K, Rajendra E, Nietlispach D, Owen D, Mott HR: The structure of binder of Arl2 (BART) reveals a novel G protein binding domain: implications for function. J Biol Chem. 2009 Jan 9;284(2):992-9. doi: 10.1074/jbc.M806167200. Epub 2008 Nov 3. [Article]
  15. Tian G, Thomas S, Cowan NJ: Effect of TBCD and its regulatory interactor Arl2 on tubulin and microtubule integrity. Cytoskeleton (Hoboken). 2010 Nov;67(11):706-14. doi: 10.1002/cm.20480. [Article]
  16. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  17. Miyake N, Fukai R, Ohba C, Chihara T, Miura M, Shimizu H, Kakita A, Imagawa E, Shiina M, Ogata K, Okuno-Yuguchi J, Fueki N, Ogiso Y, Suzumura H, Watabe Y, Imataka G, Leong HY, Fattal-Valevski A, Kramer U, Miyatake S, Kato M, Okamoto N, Sato Y, Mitsuhashi S, Nishino I, Kaneko N, Nishiyama A, Tamura T, Mizuguchi T, Nakashima M, Tanaka F, Saitsu H, Matsumoto N: Biallelic TBCD Mutations Cause Early-Onset Neurodegenerative Encephalopathy. Am J Hum Genet. 2016 Oct 6;99(4):950-961. doi: 10.1016/j.ajhg.2016.08.005. Epub 2016 Sep 22. [Article]
  18. Zhang T, Li S, Zhang Y, Zhong C, Lai Z, Ding J: Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector. Structure. 2009 Apr 15;17(4):602-10. doi: 10.1016/j.str.2009.01.014. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails