Beta-amylase

Details

Name
Beta-amylase
Synonyms
  • 1,4-alpha-D-glucan maltohydrolase
  • 3.2.1.2
Gene Name
spoII
Organism
Bacillus cereus
Amino acid sequence
>lcl|BSEQ0011327|Beta-amylase
MKNQFQYCCIVILSVVMLFVSLLIPQASSAAVNGKGMNPDYKAYLMAPLKKIPEVTNWET
FENDLRWAKQNGFYAITVDFWWGDMEKNGDQQFDFSYAQRFAQSVKNAGMKMIPIISTHQ
CGGNVGDDCNVPIPSWVWNQKSDDSLYFKSETGTVNKETLNPLASDVIRKEYGELYTAFA
AAMKPYKDVIAKIYLSGGPAGELRYPSYTTSDGTGYPSRGKFQAYTEFAKSKFRLWVLNK
YGSLNEVNKAWGTKLISELAILPPSDGEQFLMNGYLSMYGKDYLEWYQGILENHTKLIGE
LAHNAFDTTFQVPIGAKIAGVHWQYNNPTIPHGAEKPAGYNDYSHLLDAFKSAKLDVTFT
CLEMTDKGSYPEYSMPKTLVQNIATLANEKGIVLNGENALSIGNEEEYKRVAEMAFNYNF
AGFTLLRYQDVMYNNSLMGKFKDLLGVTPVMQTIVVKNVPTTIGDTVYITGNRAELGSWD
TKQYPIQLYYDSHSNDWRGNVVLPAERNIEFKAFIKSKDGTVKSWQTIQQSWNPVPLKTT
SHTSSW
Number of residues
546
Molecular Weight
61628.585
Theoretical pI
6.72
GO Classification
Functions
beta-amylase activity / metal ion binding / starch binding
Processes
polysaccharide catabolic process
General Function
Starch binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0003658|1641 bp
ATGAAAAATCAGTTTCAATATTGTTGTATTGTCATTTTGTCTGTAGTGATGTTATTTGTA
TCATTATTAATTCCGCAAGCGAGTTCGGCAGCTGTAAATGGAAAAGGAATGAATCCAGAT
TACAAAGCATATTTAATGGCGCCATTAAAAAAGATACCGGAAGTAACAAATTGGGAGACA
TTTGAAAATGATTTACGATGGGCAAAACAAAATGGTTTTTATGCTATTACAGTTGATTTT
TGGTGGGGGGATATGGAAAAGAACGGAGATCAGCAATTTGATTTTTCATACGCACAGCGC
TTTGCTCAATCGGTAAAAAATGCAGGTATGAAAATGATTCCTATTATTTCCACACATCAG
TGCGGTGGAAATGTTGGGGATGATTGCAATGTACCAATTCCTTCATGGGTTTGGAATCAA
AAATCCGATGATAGCCTTTATTTTAAGTCTGAAACAGGAACTGTCAATAAAGAAACATTA
AATCCACTTGCTTCAGATGTAATTCGAAAGGAATATGGTGAACTATATACAGCATTCGCA
GCAGCTATGAAACCGTATAAAGATGTAATTGCAAAAATATATTTATCTGGAGGACCAGCT
GGTGAACTAAGATATCCTTCATATACAACTTCCGATGGGACAGGATATCCCTCACGTGGA
AAGTTTCAAGCGTATACAGAGTTTGCAAAATCTAAATTTCGTTTATGGGTATTAAATAAA
TATGGTTCTCTAAATGAAGTGAATAAAGCATGGGGCACGAAACTGATTTCAGAGTTAGCA
ATTTTACCACCAAGCGATGGGGAACAATTCTTAATGAATGGATATCTTTCTATGTATGGA
AAAGACTATTTAGAATGGTATCAGGGCATCTTGGAAAATCATACAAAATTAATTGGTGAA
TTAGCACATAACGCATTTGACACAACTTTCCAAGTACCAATTGGTGCAAAAATTGCAGGC
GTACATTGGCAATATAATAACCCAACAATACCTCATGGAGCTGAAAAGCCTGCAGGGTAT
AATGATTATAGCCATTTACTTGATGCTTTCAAAAGTGCAAAGCTAGATGTAACATTTACT
TGCTTAGAAATGACAGATAAAGGTAGTTATCCGGAATATTCAATGCCAAAAACATTGGTA
CAAAATATTGCAACATTAGCCAATGAAAAGGGAATTGTATTAAACGGTGAAAATGCTTTA
AGTATCGGAAATGAAGAAGAGTATAAAAGAGTTGCAGAAATGGCTTTCAATTATAATTTT
GCTGGATTTACGTTACTTCGTTATCAAGATGTAATGTATAACAATTCATTAATGGGGAAA
TTTAAAGATTTATTAGGTGTAACCCCTGTTATGCAAACGATTGTAGTAAAAAATGTTCCT
ACAACAATAGGAGATACTGTTTATATTACTGGGAATCGTGCGGAATTAGGAAGTTGGGAC
ACAAAACAGTATCCAATTCAATTATATTATGATTCTCATAGTAATGATTGGAGAGGAAAT
GTTGTGTTGCCAGCTGAAAGAAATATAGAATTTAAAGCATTTATTAAAAGTAAAGATGGA
ACGGTTAAATCATGGCAAACAATACAACAAAGTTGGAATCCAGTGCCACTAAAGACTACC
TCTCATACAAGTAGTTGGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP36924
UniProtKB Entry NameAMYB_BACCE
GenBank Protein ID4520330
GenBank Gene IDAB024519
General References
  1. Nanmori T, Nagai M, Shimizu Y, Shinke R, Mikami B: Cloning of the beta-amylase gene from Bacillus cereus and characteristics of the primary structure of the enzyme. Appl Environ Microbiol. 1993 Feb;59(2):623-7. [PubMed:8434930]
  2. Mikami B, Adachi M, Kage T, Sarikaya E, Nanmori T, Shinke R, Utsumi S: Structure of raw starch-digesting Bacillus cereus beta-amylase complexed with maltose. Biochemistry. 1999 Jun 1;38(22):7050-61. [PubMed:10353816]
  3. Oyama T, Miyake H, Kusunoki M, Nitta Y: Crystal structures of beta-amylase from Bacillus cereus var mycoides in complexes with substrate analogs and affinity-labeling reagents. J Biochem. 2003 Apr;133(4):467-74. [PubMed:12761294]
  4. Hirata A, Adachi M, Utsumi S, Mikami B: Engineering of the pH optimum of Bacillus cereus beta-amylase: conversion of the pH optimum from a bacterial type to a higher-plant type. Biochemistry. 2004 Oct 5;43(39):12523-31. [PubMed:15449941]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB026453,4-Epoxybutyl-Alpha-D-GlucopyranosideexperimentalunknownDetails
DB03323Maltoseexperimental, investigationalunknownDetails
DB03389alpha-D-XylopyranoseexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails