Interleukin-6 receptor subunit beta

Details

Name
Interleukin-6 receptor subunit beta
Synonyms
  • CDw130
  • gp130
  • IL-6 receptor subunit beta
  • Interleukin-6 signal transducer
  • Membrane glycoprotein 130
  • Oncostatin-M receptor subunit alpha
Gene Name
IL6ST
Organism
Humans
Amino acid sequence
>lcl|BSEQ0052507|Interleukin-6 receptor subunit beta
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ
Number of residues
918
Molecular Weight
103535.875
Theoretical pI
Not Available
GO Classification
Functions
ciliary neurotrophic factor receptor activity / ciliary neurotrophic factor receptor binding / cytokine binding / cytokine receptor activity / growth factor binding / identical protein binding / interleukin-11 binding / interleukin-11 receptor activity / interleukin-27 receptor activity
Processes
ciliary neurotrophic factor-mediated signaling pathway / cytokine-mediated signaling pathway / glycogen metabolic process / interleukin-27-mediated signaling pathway / interleukin-35-mediated signaling pathway / interleukin-6-mediated signaling pathway / leukemia inhibitory factor signaling pathway / negative regulation of apoptotic process / negative regulation of interleukin-6-mediated signaling pathway / oncostatin-M-mediated signaling pathway / positive regulation of acute inflammatory response / positive regulation of adaptive immune response / positive regulation of astrocyte differentiation / positive regulation of cardiac muscle hypertrophy / positive regulation of cell population proliferation / positive regulation of osteoblast differentiation / positive regulation of T cell proliferation / positive regulation of tyrosine phosphorylation of STAT protein / positive regulation of vascular endothelial growth factor production / regulation of Notch signaling pathway / response to cytokine / viral process
Components
ciliary neurotrophic factor receptor complex / dendrite / external side of plasma membrane / extracellular exosome / extracellular region / extracellular space / interleukin-6 receptor complex / membrane / neuronal cell body / oncostatin-M receptor complex / plasma membrane / receptor complex
General Function
Signal-transducing molecule (PubMed:2261637). The receptor systems for IL6, LIF, OSM, CNTF, IL11, CTF1 and BSF3 can utilize IL6ST for initiating signal transmission. Binding of IL6 to IL6R induces IL6ST homodimerization and formation of a high-affinity receptor complex, which activate the intracellular JAK-MAPK and JAK-STAT3 signaling pathways (PubMed:2261637, PubMed:19915009, PubMed:23294003). That causes phosphorylation of IL6ST tyrosine residues which in turn activates STAT3 (PubMed:19915009, PubMed:23294003, PubMed:25731159). In parallel, the IL6 signaling pathway induces the expression of two cytokine receptor signaling inhibitors, SOCS1 and SOCS3, which inhibit JAK and terminate the activity of the IL6 signaling pathway as a negative feedback loop (By similarity). Also activates the yes-associated protein 1 (YAP) and NOTCH pathways to control inflammation-induced epithelial regeneration, independently of STAT3 (By similarity). Mediates signals which regulate immune response, hematopoiesis, pain control and bone metabolism (By similarity). Has a role in embryonic development (By similarity). Essential for survival of motor and sensory neurons and for differentiation of astrocytes (By similarity). Required for expression of TRPA1 in nociceptive neurons (By similarity). Required for the maintenance of PTH1R expression in the osteoblast lineage and for the stimulation of PTH-induced osteoblast differentiation (By similarity). Required for normal trabecular bone mass and cortical bone composition (By similarity).
Specific Function
Ciliary neurotrophic factor receptor activity
Pfam Domain Function
Transmembrane Regions
620-641
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0052508|Interleukin-6 receptor subunit beta (IL6ST)
ATGTTGACGTTGCAGACTTGGCTAGTGCAAGCCTTGTTTATTTTCCTCACCACTGAATCT
ACAGGTGAACTTCTAGATCCATGTGGTTATATCAGTCCTGAATCTCCAGTTGTACAACTT
CATTCTAATTTCACTGCAGTTTGTGTGCTAAAGGAAAAATGTATGGATTATTTTCATGTA
AATGCTAATTACATTGTCTGGAAAACAAACCATTTTACTATTCCTAAGGAGCAATATACT
ATCATAAACAGAACAGCATCCAGTGTCACCTTTACAGATATAGCTTCATTAAATATTCAG
CTCACTTGCAACATTCTTACATTCGGACAGCTTGAACAGAATGTTTATGGAATCACAATA
ATTTCAGGCTTGCCTCCAGAAAAACCTAAAAATTTGAGTTGCATTGTGAACGAGGGGAAG
AAAATGAGGTGTGAGTGGGATGGTGGAAGGGAAACACACTTGGAGACAAACTTCACTTTA
AAATCTGAATGGGCAACACACAAGTTTGCTGATTGCAAAGCAAAACGTGACACCCCCACC
TCATGCACTGTTGATTATTCTACTGTGTATTTTGTCAACATTGAAGTCTGGGTAGAAGCA
GAGAATGCCCTTGGGAAGGTTACATCAGATCATATCAATTTTGATCCTGTATATAAAGTG
AAGCCCAATCCGCCACATAATTTATCAGTGATCAACTCAGAGGAACTGTCTAGTATCTTA
AAATTGACATGGACCAACCCAAGTATTAAGAGTGTTATAATACTAAAATATAACATTCAA
TATAGGACCAAAGATGCCTCAACTTGGAGCCAGATTCCTCCTGAAGACACAGCATCCACC
CGATCTTCATTCACTGTCCAAGACCTTAAACCTTTTACAGAATATGTGTTTAGGATTCGC
TGTATGAAGGAAGATGGTAAGGGATACTGGAGTGACTGGAGTGAAGAAGCAAGTGGGATC
ACCTATGAAGATAGACCATCTAAAGCACCAAGTTTCTGGTATAAAATAGATCCATCCCAT
ACTCAAGGCTACAGAACTGTACAACTCGTGTGGAAGACATTGCCTCCTTTTGAAGCCAAT
GGAAAAATCTTGGATTATGAAGTGACTCTCACAAGATGGAAATCACATTTACAAAATTAC
ACAGTTAATGCCACAAAACTGACAGTAAATCTCACAAATGATCGCTATCTAGCAACCCTA
ACAGTAAGAAATCTTGTTGGCAAATCAGATGCAGCTGTTTTAACTATCCCTGCCTGTGAC
TTTCAAGCTACTCACCCTGTAATGGATCTTAAAGCATTCCCCAAAGATAACATGCTTTGG
GTGGAATGGACTACTCCAAGGGAATCTGTAAAGAAATATATACTTGAGTGGTGTGTGTTA
TCAGATAAAGCACCCTGTATCACAGACTGGCAACAAGAAGATGGTACCGTGCATCGCACC
TATTTAAGAGGGAACTTAGCAGAGAGCAAATGCTATTTGATAACAGTTACTCCAGTATAT
GCTGATGGACCAGGAAGCCCTGAATCCATAAAGGCATACCTTAAACAAGCTCCACCTTCC
AAAGGACCTACTGTTCGGACAAAAAAAGTAGGGAAAAACGAAGCTGTCTTAGAGTGGGAC
CAACTTCCTGTTGATGTTCAGAATGGATTTATCAGAAATTATACTATATTTTATAGAACC
ATCATTGGAAATGAAACTGCTGTGAATGTGGATTCTTCCCACACAGAATATACATTGTCC
TCTTTGACTAGTGACACATTGTACATGGTACGAATGGCAGCATACACAGATGAAGGTGGG
AAGGATGGTCCAGAATTCACTTTTACTACCCCAAAGTTTGCTCAAGGAGAAATTGAAGCC
ATAGTCGTGCCTGTTTGCTTAGCATTCCTATTGACAACTCTTCTGGGAGTGCTGTTCTGC
TTTAATAAGCGAGACCTAATTAAAAAACACATCTGGCCTAATGTTCCAGATCCTTCAAAG
AGTCATATTGCCCAGTGGTCACCTCACACTCCTCCAAGGCACAATTTTAATTCAAAAGAT
CAAATGTATTCAGATGGCAATTTCACTGATGTAAGTGTTGTGGAAATAGAAGCAAATGAC
AAAAAGCCTTTTCCAGAAGATCTGAAATCATTGGACCTGTTCAAAAAGGAAAAAATTAAT
ACTGAAGGACACAGCAGTGGTATTGGGGGGTCTTCATGCATGTCATCTTCTAGGCCAAGC
ATTTCTAGCAGTGATGAAAATGAATCTTCACAAAACACTTCGAGCACTGTCCAGTATTCT
ACCGTGGTACACAGTGGCTACAGACACCAAGTTCCGTCAGTCCAAGTCTTCTCAAGATCC
GAGTCTACCCAGCCCTTGTTAGATTCAGAGGAGCGGCCAGAAGATCTACAATTAGTAGAT
CATGTAGATGGCGGTGATGGTATTTTGCCCAGGCAACAGTACTTCAAACAGAACTGCAGT
CAGCATGAATCCAGTCCAGATATTTCACATTTTGAAAGGTCAAAGCAAGTTTCATCAGTC
AATGAGGAAGATTTTGTTAGACTTAAACAGCAGATTTCAGATCATATTTCACAATCCTGT
GGATCTGGGCAAATGAAAATGTTTCAGGAAGTTTCTGCAGCAGATGCTTTTGGTCCAGGT
ACTGAGGGACAAGTAGAAAGATTTGAAACAGTTGGCATGGAGGCTGCGACTGATGAAGGC
ATGCCTAAAAGTTACTTACCACAGACTGTACGGCAAGGCGGCTACATGCCTCAGTGA
Chromosome Location
5
Locus
5q11.2
External Identifiers
ResourceLink
UniProtKB IDP40189
UniProtKB Entry NameIL6RB_HUMAN
HGNC IDHGNC:6021
General References
  1. Hibi M, Murakami M, Saito M, Hirano T, Taga T, Kishimoto T: Molecular cloning and expression of an IL-6 signal transducer, gp130. Cell. 1990 Dec 21;63(6):1149-57. doi: 10.1016/0092-8674(90)90411-7. [Article]
  2. Tanaka M, Kishimura M, Ozaki S, Osakada F, Hashimoto H, Okubo M, Murakami M, Nakao K: Cloning of novel soluble gp130 and detection of its neutralizing autoantibodies in rheumatoid arthritis. J Clin Invest. 2000 Jul;106(1):137-44. doi: 10.1172/JCI7479. [Article]
  3. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [Article]
  4. Moritz RL, Hall NE, Connolly LM, Simpson RJ: Determination of the disulfide structure and N-glycosylation sites of the extracellular domain of the human signal transducer gp130. J Biol Chem. 2001 Mar 16;276(11):8244-53. doi: 10.1074/jbc.M009979200. Epub 2000 Nov 29. [Article]
  5. Mosley B, De Imus C, Friend D, Boiani N, Thoma B, Park LS, Cosman D: Dual oncostatin M (OSM) receptors. Cloning and characterization of an alternative signaling subunit conferring OSM-specific receptor activation. J Biol Chem. 1996 Dec 20;271(51):32635-43. doi: 10.1074/jbc.271.51.32635. [Article]
  6. Hallek M, Neumann C, Schaffer M, Danhauser-Riedl S, von Bubnoff N, de Vos G, Druker BJ, Yasukawa K, Griffin JD, Emmerich B: Signal transduction of interleukin-6 involves tyrosine phosphorylation of multiple cytosolic proteins and activation of Src-family kinases Fyn, Hck, and Lyn in multiple myeloma cell lines. Exp Hematol. 1997 Dec;25(13):1367-77. [Article]
  7. Gibson RM, Schiemann WP, Prichard LB, Reno JM, Ericsson LH, Nathanson NM: Phosphorylation of human gp130 at Ser-782 adjacent to the Di-leucine internalization motif. Effects on expression and signaling. J Biol Chem. 2000 Jul 21;275(29):22574-82. doi: 10.1074/jbc.M907658199. [Article]
  8. Jostock T, Mullberg J, Ozbek S, Atreya R, Blinn G, Voltz N, Fischer M, Neurath MF, Rose-John S: Soluble gp130 is the natural inhibitor of soluble interleukin-6 receptor transsignaling responses. Eur J Biochem. 2001 Jan;268(1):160-7. doi: 10.1046/j.1432-1327.2001.01867.x. [Article]
  9. Li H, Wang H, Nicholas J: Detection of direct binding of human herpesvirus 8-encoded interleukin-6 (vIL-6) to both gp130 and IL-6 receptor (IL-6R) and identification of amino acid residues of vIL-6 important for IL-6R-dependent and -independent signaling. J Virol. 2001 Apr;75(7):3325-34. doi: 10.1128/JVI.75.7.3325-3334.2001. [Article]
  10. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [Article]
  11. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [Article]
  12. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [Article]
  13. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [Article]
  14. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
  15. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [Article]
  16. Waetzig GH, Chalaris A, Rosenstiel P, Suthaus J, Holland C, Karl N, Valles Uriarte L, Till A, Scheller J, Grotzinger J, Schreiber S, Rose-John S, Seegert D: N-linked glycosylation is essential for the stability but not the signaling function of the interleukin-6 signal transducer glycoprotein 130. J Biol Chem. 2010 Jan 15;285(3):1781-9. doi: 10.1074/jbc.M109.075952. Epub 2009 Nov 13. [Article]
  17. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [Article]
  18. Garbers C, Thaiss W, Jones GW, Waetzig GH, Lorenzen I, Guilhot F, Lissilaa R, Ferlin WG, Grotzinger J, Jones SA, Rose-John S, Scheller J: Inhibition of classic signaling is a novel function of soluble glycoprotein 130 (sgp130), which is controlled by the ratio of interleukin 6 and soluble interleukin 6 receptor. J Biol Chem. 2011 Dec 16;286(50):42959-70. doi: 10.1074/jbc.M111.295758. Epub 2011 Oct 11. [Article]
  19. Schutt A, Zacharias M, Schneider N, Horn S, Grotzinger J, Rose-John S, Schmidt-Arras D: gp130 activation is regulated by D2-D3 interdomain connectivity. Biochem J. 2013 Mar 15;450(3):487-96. doi: 10.1042/BJ20121660. [Article]
  20. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [Article]
  21. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  22. Taniguchi K, Wu LW, Grivennikov SI, de Jong PR, Lian I, Yu FX, Wang K, Ho SB, Boland BS, Chang JT, Sandborn WJ, Hardiman G, Raz E, Maehara Y, Yoshimura A, Zucman-Rossi J, Guan KL, Karin M: A gp130-Src-YAP module links inflammation to epithelial regeneration. Nature. 2015 Mar 5;519(7541):57-62. doi: 10.1038/nature14228. Epub 2015 Feb 25. [Article]
  23. Lokau J, Nitz R, Agthe M, Monhasery N, Aparicio-Siegmund S, Schumacher N, Wolf J, Moller-Hackbarth K, Waetzig GH, Grotzinger J, Muller-Newen G, Rose-John S, Scheller J, Garbers C: Proteolytic Cleavage Governs Interleukin-11 Trans-signaling. Cell Rep. 2016 Feb 23;14(7):1761-1773. doi: 10.1016/j.celrep.2016.01.053. Epub 2016 Feb 11. [Article]
  24. Lamertz L, Rummel F, Polz R, Baran P, Hansen S, Waetzig GH, Moll JM, Floss DM, Scheller J: Soluble gp130 prevents interleukin-6 and interleukin-11 cluster signaling but not intracellular autocrine responses. Sci Signal. 2018 Oct 2;11(550). pii: 11/550/eaar7388. doi: 10.1126/scisignal.aar7388. [Article]
  25. Bravo J, Staunton D, Heath JK, Jones EY: Crystal structure of a cytokine-binding region of gp130. EMBO J. 1998 Mar 16;17(6):1665-74. doi: 10.1093/emboj/17.6.1665. [Article]
  26. Chow D, He X, Snow AL, Rose-John S, Garcia KC: Structure of an extracellular gp130 cytokine receptor signaling complex. Science. 2001 Mar 16;291(5511):2150-5. doi: 10.1126/science.1058308. [Article]
  27. Boulanger MJ, Bankovich AJ, Kortemme T, Baker D, Garcia KC: Convergent mechanisms for recognition of divergent cytokines by the shared signaling receptor gp130. Mol Cell. 2003 Sep;12(3):577-89. doi: 10.1016/s1097-2765(03)00365-4. [Article]
  28. Boulanger MJ, Chow DC, Brevnova EE, Garcia KC: Hexameric structure and assembly of the interleukin-6/IL-6 alpha-receptor/gp130 complex. Science. 2003 Jun 27;300(5628):2101-4. [Article]
  29. Xu Y, Kershaw NJ, Luo CS, Soo P, Pocock MJ, Czabotar PE, Hilton DJ, Nicola NA, Garrett TP, Zhang JG: Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes. J Biol Chem. 2010 Jul 9;285(28):21214-8. doi: 10.1074/jbc.C110.129502. Epub 2010 May 20. [Article]
  30. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [Article]
  31. Sun L, Sui L, Cong X, Ma K, Ma X, Huang Y, Fan C, Fu X, Ma K: Low incidence of IL6ST (gp130) mutations in exon 6 in lung cancer of a Chinese cohort. Cancer Genet. 2014 Jul-Aug;207(7-8):291-8. doi: 10.1016/j.cancergen.2014.07.003. Epub 2014 Aug 1. [Article]
  32. Wonnerth A, Katsaros KM, Krychtiuk KA, Speidl WS, Kaun C, Thaler K, Huber K, Wojta J, Maurer G, Seljeflot I, Arnesen H, Weiss TW: Glycoprotein 130 polymorphism predicts soluble glycoprotein 130 levels. Metabolism. 2014 May;63(5):647-53. doi: 10.1016/j.metabol.2014.02.005. Epub 2014 Feb 14. [Article]
  33. Schwerd T, Twigg SRF, Aschenbrenner D, Manrique S, Miller KA, Taylor IB, Capitani M, McGowan SJ, Sweeney E, Weber A, Chen L, Bowness P, Riordan A, Cant A, Freeman AF, Milner JD, Holland SM, Frede N, Muller M, Schmidt-Arras D, Grimbacher B, Wall SA, Jones EY, Wilkie AOM, Uhlig HH: A biallelic mutation in IL6ST encoding the GP130 co-receptor causes immunodeficiency and craniosynostosis. J Exp Med. 2017 Sep 4;214(9):2547-2562. doi: 10.1084/jem.20161810. Epub 2017 Jul 26. [Article]
  34. Shahin T, Aschenbrenner D, Cagdas D, Bal SK, Conde CD, Garncarz W, Medgyesi D, Schwerd T, Karaatmaca B, Cetinkaya PG, Esenboga S, Twigg SRF, Cant A, Wilkie AOM, Tezcan I, Uhlig HH, Boztug K: Selective loss of function variants in IL6ST cause Hyper-IgE syndrome with distinct impairments of T-cell phenotype and function. Haematologica. 2019 Mar;104(3):609-621. doi: 10.3324/haematol.2018.194233. Epub 2018 Oct 11. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails