B-cell antigen receptor complex-associated protein beta chain
Details
- Name
- B-cell antigen receptor complex-associated protein beta chain
- Synonyms
- B-cell-specific glycoprotein B29
- B29
- Ig-beta
- IGB
- Immunoglobulin-associated B29 protein
- Gene Name
- CD79B
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0052040|B-cell antigen receptor complex-associated protein beta chain MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
- Number of residues
- 229
- Molecular Weight
- 26047.65
- Theoretical pI
- Not Available
- GO Classification
- Functionsidentical protein binding / protein homodimerization activity / transmembrane signaling receptor activityProcessesadaptive immune response / B cell differentiation / B cell receptor signaling pathway / immune response / protein homooligomerization / response to bacterium / signal transductionComponentsB cell receptor complex / cytosol / external side of plasma membrane / extracellular exosome / Golgi apparatus / integral component of plasma membrane / nucleoplasm / plasma membrane
- General Function
- Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
- Specific Function
- Identical protein binding
- Pfam Domain Function
- V-set (PF07686)
- Transmembrane Regions
- 160-180
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0052041|B-cell antigen receptor complex-associated protein beta chain (CD79B) ATGGCCAGGCTGGCGTTGTCTCCTGTGCCCAGCCACTGGATGGTGGCGTTGCTGCTGCTG CTCTCAGCTGAGCCAGTACCAGCAGCCAGATCGGAGGACCGGTACCGGAATCCCAAAGGT AGTGCTTGTTCGCGGATCTGGCAGAGCCCACGTTTCATAGCCAGGAAACGGGGCTTCACG GTGAAAATGCACTGCTACATGAACAGCGCCTCCGGCAATGTGAGCTGGCTCTGGAAGCAG GAGATGGACGAGAATCCCCAGCAGCTGAAGCTGGAAAAGGGCCGCATGGAAGAGTCCCAG AACGAATCTCTCGCCACCCTCACCATCCAAGGCATCCGGTTTGAGGACAATGGCATCTAC TTCTGTCAGCAGAAGTGCAACAACACCTCGGAGGTCTACCAGGGCTGCGGCACAGAGCTG CGAGTCATGGGATTCAGCACCTTGGCACAGCTGAAGCAGAGGAACACGCTGAAGGATGGT ATCATCATGATCCAGACGCTGCTGATCATCCTCTTCATCATCGTGCCTATCTTCCTGCTG CTGGACAAGGATGACAGCAAGGCTGGCATGGAGGAAGATCACACCTACGAGGGCCTGGAC ATTGACCAGACAGCCACCTATGAGGACATAGTGACGCTGCGGACAGGGGAAGTGAAGTGG TCTGTAGGTGAGCACCCAGGCCAGGAGTGA
- Chromosome Location
- 17
- Locus
- 17q23.3
- External Identifiers
Resource Link UniProtKB ID P40259 UniProtKB Entry Name CD79B_HUMAN HGNC ID HGNC:1699 - General References
- Muller B, Cooper L, Terhorst C: Cloning and sequencing of the cDNA encoding the human homologue of the murine immunoglobulin-associated protein B29. Eur J Immunol. 1992 Jun;22(6):1621-5. doi: 10.1002/eji.1830220641. [Article]
- Wood WJ Jr, Thompson AA, Korenberg J, Chen XN, May W, Wall R, Denny CT: Isolation and chromosomal mapping of the human immunoglobulin-associated B29 gene (IGB). Genomics. 1993 Apr;16(1):187-92. doi: 10.1006/geno.1993.1157. [Article]
- Hashimoto S, Gregersen PK, Chiorazzi N: The human Ig-beta cDNA sequence, a homologue of murine B29, is identical in B cell and plasma cell lines producing all the human Ig isotypes. J Immunol. 1993 Jan 15;150(2):491-8. [Article]
- Hashimoto S, Chiorazzi N, Gregersen PK: The complete sequence of the human CD79b (Ig beta/B29) gene: identification of a conserved exon/intron organization, immunoglobulin-like regulatory regions, and allelic polymorphism. Immunogenetics. 1994;40(2):145-9. [Article]
- Hashimoto S, Chiorazzi N, Gregersen PK: Alternative splicing of CD79a (Ig-alpha/mb-1) and CD79b (Ig-beta/B29) RNA transcripts in human B cells. Mol Immunol. 1995 Jun;32(9):651-9. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Vasile S, Coligan JE, Yoshida M, Seon BK: Isolation and chemical characterization of the human B29 and mb-1 proteins of the B cell antigen receptor complex. Mol Immunol. 1994 Apr;31(6):419-27. [Article]
- Luisiri P, Lee YJ, Eisfelder BJ, Clark MR: Cooperativity and segregation of function within the Ig-alpha/beta heterodimer of the B cell antigen receptor complex. J Biol Chem. 1996 Mar 1;271(9):5158-63. doi: 10.1074/jbc.271.9.5158. [Article]
- Tseng J, Eisfelder BJ, Clark MR: B-cell antigen receptor-induced apoptosis requires both Ig alpha and Ig beta. Blood. 1997 Mar 1;89(5):1513-20. [Article]
- Pelanda R, Braun U, Hobeika E, Nussenzweig MC, Reth M: B cell progenitors are arrested in maturation but have intact VDJ recombination in the absence of Ig-alpha and Ig-beta. J Immunol. 2002 Jul 15;169(2):865-72. doi: 10.4049/jimmunol.169.2.865. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Radaev S, Zou Z, Tolar P, Nguyen K, Nguyen A, Krueger PD, Stutzman N, Pierce S, Sun PD: Structural and functional studies of Igalphabeta and its assembly with the B cell antigen receptor. Structure. 2010 Aug 11;18(8):934-43. doi: 10.1016/j.str.2010.04.019. [Article]
- Dobbs AK, Yang T, Farmer D, Kager L, Parolini O, Conley ME: Cutting edge: a hypomorphic mutation in Igbeta (CD79b) in a patient with immunodeficiency and a leaky defect in B cell development. J Immunol. 2007 Aug 15;179(4):2055-9. doi: 10.4049/jimmunol.179.4.2055. [Article]