Tyrosine-protein kinase CSK

Details

Name
Tyrosine-protein kinase CSK
Synonyms
  • 2.7.10.2
  • C-Src kinase
  • Protein-tyrosine kinase CYL
Gene Name
CSK
Organism
Humans
Amino acid sequence
>lcl|BSEQ0021663|Tyrosine-protein kinase CSK
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Number of residues
450
Molecular Weight
50703.975
Theoretical pI
7.07
GO Classification
Functions
ATP binding / identical protein binding / metal ion binding / non-membrane spanning protein tyrosine kinase activity / protein C-terminus binding / protein kinase A catalytic subunit binding / protein tyrosine kinase activity / receptor binding
Processes
adaptive immune response / adherens junction organization / blood coagulation / brain development / cell differentiation / cell migration / cellular response to peptide hormone stimulus / epidermal growth factor receptor signaling pathway / innate immune response / morphogenesis of an epithelium / negative regulation of bone resorption / negative regulation of cell proliferation / negative regulation of ERK1 and ERK2 cascade / negative regulation of Golgi to plasma membrane protein transport / negative regulation of interleukin-6 production / negative regulation of kinase activity / negative regulation of low-density lipoprotein particle clearance / negative regulation of phagocytosis / oligodendrocyte differentiation / peptidyl-tyrosine autophosphorylation / platelet activation / positive regulation of MAP kinase activity / protein phosphorylation / regulation of cell proliferation / regulation of cytokine production / regulation of Fc receptor mediated stimulatory signaling pathway / T cell costimulation / T cell receptor signaling pathway / transmembrane receptor protein tyrosine kinase signaling pathway
Components
cell-cell junction / cytoplasm / cytosol / extracellular exosome / extrinsic component of cytoplasmic side of plasma membrane / membrane raft / plasma membrane
General Function
Receptor binding
Specific Function
Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0021664|Tyrosine-protein kinase CSK (CSK)
ATGTCAGCAATACAGGCCGCCTGGCCATCCGGTACAGAATGTATTGCCAAGTACAACTTC
CACGGCACTGCCGAGCAGGACCTGCCCTTCTGCAAAGGAGACGTGCTCACCATTGTGGCC
GTCACCAAGGACCCCAACTGGTACAAAGCCAAAAACAAGGTGGGCCGTGAGGGCATCATC
CCAGCCAACTACGTCCAGAAGCGGGAGGGCGTGAAGGCGGGTACCAAACTCAGCCTCATG
CCTTGGTTCCACGGCAAGATCACACGGGAGCAGGCTGAGCGGCTTCTGTACCCGCCGGAG
ACAGGCCTGTTCCTGGTGCGGGAGAGCACCAACTACCCCGGAGACTACACGCTGTGCGTG
AGCTGCGACGGCAAGGTGGAGCACTACCGCATCATGTACCATGCCAGCAAGCTCAGCATC
GACGAGGAGGTGTACTTTGAGAACCTCATGCAGCTGGTGGAGCACTACACCTCAGACGCA
GATGGACTCTGTACGCGCCTCATTAAACCAAAGGTCATGGAGGGCACAGTGGCGGCCCAG
GATGAGTTCTACCGCAGCGGCTGGGCCCTGAACATGAAGGAGCTGAAGCTGCTGCAGACC
ATCGGGAAGGGGGAGTTCGGAGACGTGATGCTGGGCGATTACCGAGGGAACAAAGTCGCC
GTCAAGTGCATTAAGAACGACGCCACTGCCCAGGCCTTCCTGGCTGAAGCCTCAGTCATG
ACGCAACTGCGGCATAGCAACCTGGTGCAGCTCCTGGGCGTGATCGTGGAGGAGAAGGGC
GGGCTCTACATCGTCACTGAGTACATGGCCAAGGGGAGCCTTGTGGACTACCTGCGGTCT
AGGGGTCGGTCAGTGCTGGGCGGAGACTGTCTCCTCAAGTTCTCGCTAGATGTCTGCGAG
GCCATGGAATACCTGGAGGGCAACAATTTCGTGCATCGAGACCTGGCTGCCCGCAATGTG
CTGGTGTCTGAGGACAACGTGGCCAAGGTCAGCGACTTTGGTCTCACCAAGGAGGCGTCC
AGCACCCAGGACACGGGCAAGCTGCCAGTCAAGTGGACAGCCCCTGAGGCCCTGAGAGAG
AAGAAATTCTCCACTAAGTCTGACGTGTGGAGTTTCGGAATCCTTCTCTGGGAAATCTAC
TCCTTTGGGCGAGTGCCTTATCCAAGAATTCCCCTGAAGGACGTCGTCCCTCGGGTGGAG
AAGGGCTACAAGATGGATGCCCCCGACGGCTGCCCGCCCGCAGTCTATGAAGTCATGAAG
AACTGCTGGCACCTGGACGCCGCCATGCGGCCCTCCTTCCTACAGCTCCGAGAGCAGCTT
GAGCACATCAAAACCCACGAGCTGCACCTGTGA
Chromosome Location
15
Locus
15q23-q25
External Identifiers
ResourceLink
UniProtKB IDP41240
UniProtKB Entry NameCSK_HUMAN
GenBank Protein ID30315
GenBank Gene IDX60114
GenAtlas IDCSK
HGNC IDHGNC:2444
General References
  1. Partanen J, Armstrong E, Bergman M, Makela TP, Hirvonen H, Huebner K, Alitalo K: cyl encodes a putative cytoplasmic tyrosine kinase lacking the conserved tyrosine autophosphorylation site (Y416src). Oncogene. 1991 Nov;6(11):2013-8. [Article]
  2. Holtrich U, Brauninger A, Strebhardt K, Rubsamen-Waigmann H: Two additional protein-tyrosine kinases expressed in human lung: fourth member of the fibroblast growth factor receptor family and an intracellular protein-tyrosine kinase. Proc Natl Acad Sci U S A. 1991 Dec 1;88(23):10411-5. [Article]
  3. Brauninger A, Holtrich U, Strebhardt K, Rubsamen-Waigmann H: Isolation and characterization of a human gene that encodes a new subclass of protein tyrosine kinases. Gene. 1992 Jan 15;110(2):205-11. [Article]
  4. Brauninger A, Karn T, Strebhardt K, Rubsamen-Waigmann H: Characterization of the human CSK locus. Oncogene. 1993 May;8(5):1365-9. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Bergman M, Mustelin T, Oetken C, Partanen J, Flint NA, Amrein KE, Autero M, Burn P, Alitalo K: The human p50csk tyrosine kinase phosphorylates p56lck at Tyr-505 and down regulates its catalytic activity. EMBO J. 1992 Aug;11(8):2919-24. [Article]
  7. Bougeret C, Rothhut B, Jullien P, Fischer S, Benarous R: Recombinant Csk expressed in Escherichia coli is autophosphorylated on tyrosine residue(s). Oncogene. 1993 May;8(5):1241-7. [Article]
  8. Sun G, Budde RJ: Expression, purification, and initial characterization of human Yes protein tyrosine kinase from a bacterial expression system. Arch Biochem Biophys. 1997 Sep 1;345(1):135-42. [Article]
  9. Joukov V, Vihinen M, Vainikka S, Sowadski JM, Alitalo K, Bergman M: Identification of csk tyrosine phosphorylation sites and a tyrosine residue important for kinase domain structure. Biochem J. 1997 Mar 15;322 ( Pt 3):927-35. [Article]
  10. Ishino M, Aoto H, Sasaski H, Suzuki R, Sasaki T: Phosphorylation of Hic-5 at tyrosine 60 by CAKbeta and Fyn. FEBS Lett. 2000 Jun 2;474(2-3):179-83. [Article]
  11. Brdicka T, Pavlistova D, Leo A, Bruyns E, Korinek V, Angelisova P, Scherer J, Shevchenko A, Hilgert I, Cerny J, Drbal K, Kuramitsu Y, Kornacker B, Horejsi V, Schraven B: Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation. J Exp Med. 2000 May 1;191(9):1591-604. [Article]
  12. Pfrepper KI, Marie-Cardine A, Simeoni L, Kuramitsu Y, Leo A, Spicka J, Hilgert I, Scherer J, Schraven B: Structural and functional dissection of the cytoplasmic domain of the transmembrane adaptor protein SIT (SHP2-interacting transmembrane adaptor protein). Eur J Immunol. 2001 Jun;31(6):1825-36. [Article]
  13. Vang T, Torgersen KM, Sundvold V, Saxena M, Levy FO, Skalhegg BS, Hansson V, Mustelin T, Tasken K: Activation of the COOH-terminal Src kinase (Csk) by cAMP-dependent protein kinase inhibits signaling through the T cell receptor. J Exp Med. 2001 Feb 19;193(4):497-507. [Article]
  14. Brdickova N, Brdicka T, Angelisova P, Horvath O, Spicka J, Hilgert I, Paces J, Simeoni L, Kliche S, Merten C, Schraven B, Horejsi V: LIME: a new membrane Raft-associated adaptor protein involved in CD4 and CD8 coreceptor signaling. J Exp Med. 2003 Nov 17;198(10):1453-62. Epub 2003 Nov 10. [Article]
  15. Begovich AB, Carlton VE, Honigberg LA, Schrodi SJ, Chokkalingam AP, Alexander HC, Ardlie KG, Huang Q, Smith AM, Spoerke JM, Conn MT, Chang M, Chang SY, Saiki RK, Catanese JJ, Leong DU, Garcia VE, McAllister LB, Jeffery DA, Lee AT, Batliwalla F, Remmers E, Criswell LA, Seldin MF, Kastner DL, Amos CI, Sninsky JJ, Gregersen PK: A missense single-nucleotide polymorphism in a gene encoding a protein tyrosine phosphatase (PTPN22) is associated with rheumatoid arthritis. Am J Hum Genet. 2004 Aug;75(2):330-7. Epub 2004 Jun 18. [Article]
  16. Chong YP, Mulhern TD, Cheng HC: C-terminal Src kinase (CSK) and CSK-homologous kinase (CHK)--endogenous negative regulators of Src-family protein kinases. Growth Factors. 2005 Sep;23(3):233-44. [Article]
  17. Di Stefano P, Damiano L, Cabodi S, Aramu S, Tordella L, Praduroux A, Piva R, Cavallo F, Forni G, Silengo L, Tarone G, Turco E, Defilippi P: p140Cap protein suppresses tumour cell properties, regulating Csk and Src kinase activity. EMBO J. 2007 Jun 20;26(12):2843-55. Epub 2007 May 24. [Article]
  18. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [Article]
  19. Levinson NM, Visperas PR, Kuriyan J: The tyrosine kinase Csk dimerizes through Its SH3 domain. PLoS One. 2009 Nov 4;4(11):e7683. doi: 10.1371/journal.pone.0007683. [Article]
  20. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  21. Wang H, Zeng X, Fan Z, Lim B: RhoH modulates pre-TCR and TCR signalling by regulating LCK. Cell Signal. 2011 Jan;23(1):249-58. doi: 10.1016/j.cellsig.2010.09.009. Epub 2010 Sep 16. [Article]
  22. Draber P, Vonkova I, Stepanek O, Hrdinka M, Kucova M, Skopcova T, Otahal P, Angelisova P, Horejsi V, Yeung M, Weiss A, Brdicka T: SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling. Mol Cell Biol. 2011 Nov;31(22):4550-62. doi: 10.1128/MCB.05817-11. Epub 2011 Sep 19. [Article]
  23. Borchert TV, Mathieu M, Zeelen JP, Courtneidge SA, Wierenga RK: The crystal structure of human CskSH3: structural diversity near the RT-Src and n-Src loop. FEBS Lett. 1994 Mar 14;341(1):79-85. [Article]
  24. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02010StaurosporineexperimentalunknownDetails
DB05075TG-100801investigationalunknownDetails
DB01254Dasatinibapproved, investigationalunknownDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails