Potassium-transporting ATPase subunit beta

Details

Name
Potassium-transporting ATPase subunit beta
Synonyms
  • Gastric H(+)/K(+) ATPase subunit beta
  • Proton pump beta chain
Gene Name
ATP4B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010431|Potassium-transporting ATPase subunit beta
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLY
VLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGY
SPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFI
IKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPH
YSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Number of residues
291
Molecular Weight
33366.95
Theoretical pI
7.37
GO Classification
Functions
hydrogen
Processes
cell adhesion / hydrogen ion transmembrane transport / ion transmembrane transport / response to lipopolysaccharide / response to organonitrogen compound / sodium ion transport / transmembrane transport
Components
plasma membrane / sodium
General Function
Hydrogen:potassium-exchanging atpase activity
Specific Function
Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Pfam Domain Function
Transmembrane Regions
37-57
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010432|Potassium-transporting ATPase subunit beta (ATP4B)
ATGGCGGCTCTGCAGGAGAAGAAGACGTGTGGCCAGCGCATGGAGGAGTTCCAGCGTTAC
TGCTGGAACCCGGACACGGGGCAGATGCTGGGCCGCACCCTGTCCCGGTGGGTGTGGATC
AGCCTGTACTACGTGGCCTTCTACGTGGTGATGACTGGGCTCTTCGCCCTGTGCCTCTAT
GTGCTGATGCAGACAGTGGACCCGTACACACCGGACTACCAAGACCAGCTACGGTCACCA
GGGGTAACCTTAAGGCCGGATGTTTACGGGGAGAAAGGCCTGGAAATTGTCTACAACGTC
TCTGATAACAGAACCTGGGCAGACCTCACACAGACTCTCCACGCCTTCCTAGCAGGCTAC
TCTCCAGCAGCCCAGGAGGACAGCATCAACTGCACCTCCGAGCAGTACTTCTTCCAGGAG
AGTTTCCGCGCTCCCAACCACACCAAGTTCTCCTGCAAGTTCACGGCAGATATGCTGCAG
AACTGCTCAGGCCTGGCGGATCCCAACTTCGGCTTTGAAGAAGGAAAGCCATGTTTTATT
ATTAAAATGAACAGGATCGTCAAGTTCCTCCCCAGCAACGGCTCGGCCCCCAGAGTGGAC
TGCGCCTTCCTGGACCAGCCCCGCGAGCTCGGCCAGCCGCTGCAGGTCAAGTACTACCCT
CCCAACGGCACCTTCAGTCTGCACTACTTCCCTTATTACGGGAAGAAAGCCCAGCCCCAC
TACAGCAACCCCCTGGTGGCAGCGAAGCTCCTCAACATCCCCAGGAACGCTGAGGTCGCC
ATCGTGTGCAAGGTCATGGCGGAGCACGTGACCTTCAACAATCCCCACGACCCGTATGAA
GGGAAAGTGGAGTTCAAACTCAAGATTGAGAAGTGA
Chromosome Location
13
Locus
13q34
External Identifiers
ResourceLink
UniProtKB IDP51164
UniProtKB Entry NameATP4B_HUMAN
GenBank Protein ID184105
GenBank Gene IDM75110
GenAtlas IDATP4B
HGNC IDHGNC:820
General References
  1. Ma JY, Song YH, Sjostrand SE, Rask L, Mardh S: cDNA cloning of the beta-subunit of the human gastric H,K-ATPase. Biochem Biophys Res Commun. 1991 Oct 15;180(1):39-45. [Article]
  2. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Yoshida T, Sato R, Mahmood S, Kawasaki S, Futai M, Maeda M: GATA-6 DNA binding protein expressed in human gastric adenocarcinoma MKN45 cells. FEBS Lett. 1997 Sep 8;414(2):333-7. [Article]
  5. Bab-Dinitz E, Albeck S, Peleg Y, Brumfeld V, Gottschalk KE, Karlish SJ: A C-terminal lobe of the beta subunit of Na,K-ATPase and H,K-ATPase resembles cell adhesion molecules. Biochemistry. 2009 Sep 15;48(36):8684-91. doi: 10.1021/bi900868e. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05351Dexlansoprazoleapproved, investigationalyesinhibitorDetails
DB13620Potassium gluconateapprovednosubstrateDetails