Ferredoxin-dependent glutamate synthase 2

Details

Name
Ferredoxin-dependent glutamate synthase 2
Synonyms
  • 1.4.7.1
  • FD-GOGAT
Gene Name
gltS
Organism
Synechocystis sp. (strain PCC 6803 / Kazusa)
Amino acid sequence
>lcl|BSEQ0012002|Ferredoxin-dependent glutamate synthase 2
MSFQYPLLAPMTNSSVATNSNQPFLGQPWLVEERDACGVGFIANLRGKPDHTLVEQALKA
LGCMEHRGGCSADNDSGDGAGVMTAIPRELLAQWFNTRNLPMPDGDRLGVGMVFLPQEPS
AREVARAYVEEVVRLEKLTVLGWREVPVNSDVLGIQAKNNQPHIEQILVTCPEGCAGDEL
DRRLYIARSIIGKKLAEDFYVCSFSCRTIVYKGMVRSIILGEFYLDLKNPGYTSNFAVYH
RRFSTNTMPKWPLAQPMRLLGHNGEINTLLGNINWMAAREKELEVSGWTKAELEALTPIV
NQANSDSYNLDSALELLVRTGRSPLEAAMILVPEAYKNQPALKDYPEISDFHDYYSGLQE
PWDGPALLVFSDGKIVGAGLDRNGLRPARYCITKDDYIVLGSEAGVVDLPEVDIVEKGRL
APGQMIAVDLAEQKILKNYQIKQQAAQKYPYGEWIKIQRQTVASDSFAEKTLFNDAQTVL
QQQAAFGYTAEDVEMVVVPMASQGKEPTFCMGDDTPLAVLSHKPRLLYDYFKQRFAQVTN
PPIDPLRENLVMSLAMFLGKRGNLLEPKAESARTIKLRSPLVNEVELQAIKTGQLQVAEV
STLYDLDGVNSLETALDNLVKTAIATVQAGAEILVLTDRPNGAILTENQSFIPPLLAVGA
VHHHLIRAGLRLKASLIVDTAQCWSTHHFACLVGYGASAICPYLALESVRQWWLDEKTQK
LMENGRLDRIDLPTALKNYRQSVEAGLFKILSKMGISLLASYHGAQIFEAIGLGAELVEY
AFAGTTSRVGGLTIADVAGEVMVFHGMAFPEMAKKLENFGFVNYRPGGEYHMNSPEMSKS
LHKAVAAYKVGGNGNNGEAYDHYELYRQYLKDRPVTALRDLLDFNADQPAISLEEVESVE
SIVKRFCTGGMSLGALSREAHETLAIAMNRLGAKSNSGEGGEDVVRYLTLDDVDSEGNSP
TLPHLHGLQNGDTANSAIKQIASGRFGVTPEYLMSGKQLEIKMAQGAKPGEGGQLPGKKV
SEYIAMLRRSKPGVTLISPPPHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVAEIGIGTI
AAGVAKANADIIQISGHDGGTGASPLSSIKHAGSPWELGVTEVHRVLMENQLRDRVLLRA
DGGLKTGWDVVMAALMGAEEYGFGSIAMIAEGCIMARVCHTNNCPVGVATQQERLRQRFK
GVPGQVVNFFYFIAEEVRSLLAHLGYRSLDDIIGRTDLLKVRSDVQLSKTQNLTLDCLLN
LPDTKQNRQWLNHEPVHSNGPVLDDDILADPDIQEAINHQTTATKTYRLVNTDRTVGTRL
SGAIAKKYGNNGFEGNITLNFQGAAGQSFGAFNLDGMTLHLQGEANDYVGKGMNGGEIVI
VPHPQASFAPEDNVIIGNTCLYGATGGNLYANGRAGERFAVRNSVGKAVIEGAGDHCCEY
MTGGVIVVLGPVGRNVGAGMTGGLAYFLDEVGDLPEKINPEIITLQRITASKGEEQLKSL
ITAHVEHTGSPKGKAILANWSDYLGKFWQAVPPSEKDSPEANGDVSLTGEKTLTSV
Number of residues
1556
Molecular Weight
169497.705
Theoretical pI
5.53
GO Classification
Functions
3 iron, 4 sulfur cluster binding / glutamate synthase (ferredoxin) activity / glutamate synthase activity / metal ion binding
Processes
ammonia assimilation cycle / glutamate biosynthetic process / L-glutamate biosynthetic process
Components
cytoplasm
General Function
Metal ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005577|4674 bp
ATGTCCTTCCAATATCCGTTGCTAGCTCCTATGACAAACTCCTCTGTTGCCACCAATTCT
AACCAACCATTCCTTGGTCAACCTTGGTTAGTGGAAGAACGAGATGCCTGTGGTGTGGGT
TTTATTGCCAATCTCCGGGGTAAGCCGGACCATACCCTGGTGGAGCAGGCCCTAAAGGCT
CTGGGGTGTATGGAACATCGGGGGGGATGCAGTGCCGATAACGATTCAGGGGACGGGGCC
GGGGTGATGACCGCCATTCCTCGGGAACTACTGGCCCAGTGGTTTAACACCCGCAATTTG
CCCATGCCCGATGGCGATCGACTGGGGGTGGGAATGGTATTTTTACCCCAGGAACCCTCC
GCTAGGGAAGTGGCCCGGGCCTACGTAGAAGAAGTGGTACGGCTGGAAAAATTAACAGTG
TTAGGGTGGCGGGAAGTGCCCGTTAATTCTGATGTGCTGGGCATTCAAGCCAAAAATAAT
CAGCCCCACATTGAACAAATTTTAGTTACTTGTCCCGAAGGTTGTGCCGGAGATGAATTA
GATCGGCGATTGTACATTGCCCGCTCCATCATTGGTAAAAAATTAGCGGAAGATTTCTAC
GTTTGTTCCTTTTCCTGTCGCACCATTGTCTATAAAGGCATGGTCCGGAGCATTATTCTG
GGGGAATTTTATTTAGATTTAAAAAATCCTGGATATACCAGTAATTTCGCCGTTTACCAC
CGTCGTTTCAGCACCAATACCATGCCCAAATGGCCCCTGGCTCAACCCATGCGGCTATTG
GGTCATAACGGGGAAATTAATACCCTTTTAGGCAATATTAATTGGATGGCGGCCAGGGAA
AAAGAATTGGAAGTGTCGGGCTGGACAAAGGCGGAGTTAGAAGCATTAACTCCTATTGTT
AACCAAGCCAACAGTGATTCCTATAACCTTGATAGTGCCCTGGAATTGTTGGTGCGTACT
GGCCGCAGTCCCCTAGAAGCGGCGATGATTTTAGTGCCGGAAGCTTATAAAAATCAGCCA
GCTTTAAAAGATTACCCGGAAATTAGTGATTTCCATGACTACTACAGCGGTTTACAGGAA
CCCTGGGATGGCCCCGCTTTATTAGTATTTAGTGACGGCAAAATTGTTGGCGCTGGGCTA
GACCGGAATGGTTTACGGCCCGCCCGTTATTGCATTACCAAAGATGACTATATTGTCTTG
GGTTCCGAAGCGGGAGTCGTGGATTTACCGGAAGTAGATATTGTTGAAAAAGGTCGCCTA
GCACCGGGGCAAATGATTGCGGTGGATTTGGCTGAGCAAAAAATTCTCAAAAACTATCAA
ATTAAACAGCAGGCGGCCCAAAAATATCCCTATGGGGAATGGATAAAAATCCAGCGTCAA
ACGGTAGCTTCTGATAGCTTTGCTGAAAAAACTTTATTCAATGACGCTCAAACTGTACTG
CAACAACAGGCAGCTTTTGGCTACACCGCTCAAGATGTGGAAATGGTAGTGGTACCCATG
GCCAGCCAAGGTAAGGAACCAACTTTTTGCATGGGGGACGATACGCCCTTAGCTGTACTA
TCCCATAAACCCCGCTTACTGTACGACTATTTCAAACAGCGCTTTGCCCAGGTGACCAAT
CCCCCCATTGATCCTCTGCGGGAAAATTTGGTCATGTCCCTAGCTATGTTTTTAGGCAAA
CGGGGCAATTTGTTAGAGCCTAAAGCGAATCCGCGCCGGACGATTAAACTCCGATCGCCA
TTGGTCAATGAAGTAGAGTTACAGGCCATTAAAACTGGACAGTTGCAGGTGGCAGAAGTT
TCTACCCTTTACGATCTAGATGGGGTGAATAGTCTGGAAACCGCCTTAGATAATTTAGTT
AAAACGGCGATCGCCACTGTGCAAGCCGGGGCAGAAATCTTGGTTTTAACTGATCGTCCT
AACCGGCGCAATATTGGACTGAGAATCAAAGTTTTTATTCCCCCCTTGTTGGCAGTGGAA
GCAGTACATCACCATCTAATTCGGGCCGGGCTAAGGCTAAAAGCGTCCCTAATTGTGGAC
ACCGCCCAGTGTTGGAGTACCCATCATTTTGCCTGCTTGGTAGGCTATGGTGCTTCGGCC
ATTTGTCCCTACCTAGCGTTGGAATCCGTGCGGCAATGGTGGTTAGATGAAAAGACCCAA
AAGCTGATGGAAAATGGGCGCTTGGATCGGATTGACTTACCCACGGCGCTGAAGAATTAT
CGCCAATCCGTGGAAGCAGGATTATTTAAAATTCTCTCCAAAATGGGCATTTCCCTGCTG
GCTTCCTACCACGGTGCCCAAATCTTCGAGGCGATCGGTTTAGGGGCGGAATTGGTGGAA
TATGCCTTTGCTGGAACTACCAGTCGGGTGGGCGGTTTGACCATCGCTGATGTGGCCGGG
GAAGTAATGGTTTTCCATGGCATGGCCTTCCCGGAAATGGCTAAGAAGTTAGAGAACTTT
GGCTTTGTCAACTACCGTCCCGGCGGAGAATATCACATGAACTCGCCGGAGATGTCCAAG
TCTCTCCATAAGGCAGTGGCAGCCTACAAAGTGGGCGGTAATGGTAACAATGGGGAAGCC
TATGACCATTACGAGTTGTACCGTCAATATCTCAAAGACCGTCCTGTCACTGCCCTGCGG
GATTTGCTCGATTTCAATGCAGACCAACCGGCCATTTCCTTAGAAGAAGTGGAATCGGTG
GAAAGTATTGTCAAGCGCTTCTGTACTGGCGGTATGTCCCTCGGTGCGTTGTCCCGGGAA
GCCCATGAAACCTTGGCGATCGCCATGAATCGTTTAGGAGCTAAATCCAATTCCGGGGAA
CCCCCAGAAGATGTAGTACGTTACCTCACTCTAGATGATGTGGATAGCGAAGGAAATTCC
CCCACCTTGCCCCATCTCCACGGCCTGCAAAATGGAGACACGGCCAACTCCGCCATTAAG
CAAATTGCCTCCGGTCGTTTTGGGGTTACCCCGGAATATTTGATGAGTGGCAAACAGTTG
GAAATTAAAATGGCCCAGGGTGCTAAACCTGGGGAAGGGGGGCAGTTACCAGGCAAAAAA
GTCAGTGAATATATTGCCATGTTGCGCCGTTCTAAACCCGGTGTAACCCTCATTTCTCCG
CCGCCCCACCATGACATTTACTCCATCGAAGATTTAGCCCAATTAATTTACGATCTCCTA
CAAATCAATCCCGAAGCCCAGGTATCGGTGAAATTGGTGGCGGAAATTGGTATTGGTACG
ATCGCCGCTGGGGTTGCTAAGGCCAATGCGGATATTATCCAAATTTCTGGCCATGACGGT
GGTACAGGGGCATCACCTTTAAGCTCCATTAAACACGCTGGTTCTCCCTGGGAGCTTGGT
GTTACGGAAGTGCATCGGGTGTTAATGGAAAACCAACTGCGCGATCGGGTTTTGCTGCGG
GCTGATGGTGGTCTGAAAACCGGTTGGGACGTAGTGATGGCCGCCCTTATGGGAGCGGAG
GAGTATGGCTTTGGCTCCATTGCCATGATTGCCGAAGGTTGCATTATGGCCCGGGTTTGC
CACACTAATAATTGTCCCGTCGGGGTTGCCACCCAGCAAGAACGGTTACGGCAACGCTTT
AAAGGAGTGCCGGGGCAGGTGGTTAATTTCTTCTATTTCATTGCCGAGGAAGTGCGCTCC
CTGTTGGCCCATTTAGGTTATCGCAGTTTGGACGACATCATTGGCCGCACTGATCTACTC
AAAGTTCGCTCCGATGTCCAGTTGAGCAAAACCCAGAATCTGACCTTAGATTGTCTGTTA
AATTTGCCCGACACGAAGCAAAACCGGCAATGGTTAAATCACGAACCAGTCCACAGCAAC
GGCCCAGTGTTGGACGACGACATTTTGGCCGACCCTGACATCCAAAGGAAAGCCATTAAC
CATCAAACCACTGCGACCAAAACCTATCGGCTGGACAATACCGACCGCACTGTGGGCACC
CGTCTCTCCGGGTCGATCGCGAAAAAGTATGGCAACAATGGTTTTGAAGGTAACATTACC
CTCAACTTCCAAGGCGCCGCTGGTCAGAGTTTTGGTGCCTTTAACCTGGATGGCATGACC
CTACATCTGCAAGGGGAAGCCAACGACTATGTGGGCAAAGGCATGAATGGGGGTGAAATT
GTCATCGTGCCCCATCCCCAGGCGAGCTTTGCACCGGAAGACAATGTAATTATTGGTAAC
ACCTGTCTCTATGGAGCGACGGGGGGCAACCTTTATGCCAACGGCCGGGCGGGGGAACGC
TTTGCAGTGCGTAACTCCGTGGGTAAAGCCGTGATTGAAGGAGCTGGCGATCACTGTTGT
GAATATATGACCGGTGGCGTGATTGTCGTCCTTGGCCCTGTGGGTCGGAACGTTGGTGCT
GGCATGACTGGTGGTTTGGCTTACTTCCTCGATGAAGTAGGGGATTTACCAGAAAAAATC
AACCCGGAAATCATCACCTTGCAAAGGATCACAGCTTCTAAAGGGGAGGAACAATTGAAA
TCCTTGATTACTGCCCACGTTGAACACACAGGTAGCCCAAAAGGCAAGGCAATTCTGGCT
AACTGGTCCGATTATCTCGGCAAATTCTGGCAGGCCCCTCCTTCCGAAAAAGACTCTCCT
GAAGCCAATGGGGATGTCAGCTTAACCGGGGAGAAGACACTGACCTCTGTCTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP55038
UniProtKB Entry NameGLTS_SYNY3
GenBank Gene IDX92480
General References
  1. Navarro F, Chavez S, Candau P, Florencio FJ: Existence of two ferredoxin-glutamate synthases in the cyanobacterium Synechocystis sp. PCC 6803. Isolation and insertional inactivation of gltB and gltS genes. Plant Mol Biol. 1995 Feb;27(4):753-67. [PubMed:7727752]
  2. Kaneko T, Sato S, Kotani H, Tanaka A, Asamizu E, Nakamura Y, Miyajima N, Hirosawa M, Sugiura M, Sasamoto S, Kimura T, Hosouchi T, Matsuno A, Muraki A, Nakazaki N, Naruo K, Okumura S, Shimpo S, Takeuchi C, Wada T, Watanabe A, Yamada M, Yasuda M, Tabata S: Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp. strain PCC6803. II. Sequence determination of the entire genome and assignment of potential protein-coding regions. DNA Res. 1996 Jun 30;3(3):109-36. [PubMed:8905231]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails