Chorismate synthase

Details

Name
Chorismate synthase
Synonyms
  • 4.2.3.5
  • 5-enolpyruvylshikimate-3-phosphate phospholyase
  • CS
Gene Name
aroC
Organism
Helicobacter pylori (strain ATCC 700392 / 26695)
Amino acid sequence
>lcl|BSEQ0012113|Chorismate synthase
MNTLGRFLRLTTFGESHGDVIGGVLDGMPSGIKIDYALLENEMKRRQGGRNVFITPRKED
DKVEITSGVFEDFSTGTPIGFLIHNQRARSKDYDNIKNLFRPSHADFTYFHKYGIRDFRG
GGRSSARESAIRVAAGAFAKMLLREIGIVCESGIIEIGGIKAKNYDFNHALKSEIFALDE
EQEEAQKTAIQNAIKNHDSIGGVALIRARSIKTNQKLPIGLGQGLYAKLDAKIAEAMMGL
NGVKAVEIGKGVESSLLKGSEYNDLMDQKGFLSNRSGGVLGGMSNGEEIIVRVHFKPTPS
IFQPQRTIDINGNECECLLKGRHDPCIAIRGSVVCESLLALVLADMVLLNLTSKIEYLKT
IYNEN
Number of residues
365
Molecular Weight
40099.6
Theoretical pI
8.21
GO Classification
Functions
chorismate synthase activity / FMN binding
Processes
aromatic amino acid family biosynthetic process / chorismate biosynthetic process
General Function
Fmn binding
Specific Function
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012114|Chorismate synthase (aroC)
ATGAACACTTTGGGGCGTTTTTTAAGGCTCACGACTTTTGGGGAATCGCATGGGGATGTG
ATAGGGGGGGTATTAGACGGCATGCCTAGCGGGATTAAAATAGACTATGCGCTATTAGAA
AATGAAATGAAGCGCCGCCAAGGGGGGAGGAACGTTTTCATTACGCCACGAAAAGAAGAC
GATAAAGTGGAAATAACAAGCGGGGTTTTTGAAGATTTTAGCACAGGGACTCCTATAGGG
TTTTTAATCCACAACCAAAGGGCTAGGAGCAAGGATTACGATAACATTAAAAACCTTTTT
AGGCCTAGCCATGCGGATTTCACTTATTTTCATAAATACGGCATTAGGGATTTTAGGGGT
GGGGGGAGGAGTTCGGCCAGAGAGAGTGCTATAAGAGTGGCTGCTGGGGCGTTTGCTAAA
ATGCTTTTAAGAGAAATCGGTATTGTTTGTGAAAGCGGGATTATAGAAATTGGGGGTATT
AAAGCCAAAAATTATGATTTTAATCACGCCTTAAAAAGCGAGATTTTTGCCCTAGATGAA
GAACAAGAAGAAGCGCAAAAAACAGCCATTCAAAACGCTATCAAAAACCACGATAGCATA
GGGGGTGTGGCTTTGATTAGAGCGAGGAGCATAAAAACCAATCAAAAGCTCCCCATTGGC
TTAGGTCAAGGGCTATACGCTAAATTAGACGCTAAAATCGCTGAAGCGATGATGGGGCTT
AATGGGGTGAAAGCGGTTGAAATAGGCAAGGGGGTAGAAAGCTCTTTATTAAAAGGCTCA
GAGTATAATGATTTAATGGATCAAAAGGGGTTTTTGAGCAATCGTAGCGGAGGGGTTTTA
GGGGGCATGAGCAATGGGGAAGAAATCATTGTTAGAGTGCATTTCAAACCCACGCCAAGC
ATTTTCCAACCTCAACGAACCATAGACATTAATGGCAATGAGTGCGAATGCTTGTTAAAG
GGCAGGCATGATCCTTGCATTGCGATTAGAGGGAGCGTGGTGTGCGAGAGTTTGTTAGCG
TTGGTGTTGGCTGATATGGTATTACTCAATTTGACTTCAAAAATAGAGTATTTAAAAACG
ATTTATAATGAGAATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP56122
UniProtKB Entry NameAROC_HELPY
GenBank Gene IDAE000511
General References
  1. Tomb JF, White O, Kerlavage AR, Clayton RA, Sutton GG, Fleischmann RD, Ketchum KA, Klenk HP, Gill S, Dougherty BA, Nelson K, Quackenbush J, Zhou L, Kirkness EF, Peterson S, Loftus B, Richardson D, Dodson R, Khalak HG, Glodek A, McKenney K, Fitzegerald LM, Lee N, Adams MD, Hickey EK, Berg DE, Gocayne JD, Utterback TR, Peterson JD, Kelley JM, Cotton MD, Weidman JM, Fujii C, Bowman C, Watthey L, Wallin E, Hayes WS, Borodovsky M, Karp PD, Smith HO, Fraser CM, Venter JC: The complete genome sequence of the gastric pathogen Helicobacter pylori. Nature. 1997 Aug 7;388(6642):539-47. [PubMed:9252185]
  2. Ahn HJ, Yoon HJ, Lee B 2nd, Suh SW: Crystal structure of chorismate synthase: a novel FMN-binding protein fold and functional insights. J Mol Biol. 2004 Feb 27;336(4):903-15. [PubMed:15095868]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails