50S ribosomal protein L22
Details
- Name
- 50S ribosomal protein L22
- Synonyms
- Not Available
- Gene Name
- rplV
- Organism
- Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
- Amino acid sequence
>lcl|BSEQ0052077|50S ribosomal protein L22 MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVA NAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAEK
- Number of residues
- 114
- Molecular Weight
- 12200.055
- Theoretical pI
- Not Available
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosomeProcessesresponse to antibiotic / translationComponentslarge ribosomal subunit
- General Function
- This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity).
- Specific Function
- Rrna binding
- Pfam Domain Function
- Ribosomal_L22 (PF00237)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0052078|50S ribosomal protein L22 (rplV) ATGGCAGAAATTACTTCAGCTAAAGCAATGGCTCGTACAGTACGTGTTTCACCTCGTAAA TCACGTCTTGTTCTTGATAACATCCGTGGTAAAAGCGTAGCCGATGCAATCGCAATCTTG ACATTCACTCCAAACAAAGCTGCTGAAATCATCTTGAAAGTTTTGAACTCAGCTGTAGCT AACGCTGAAAACAACTTTGGTTTGGATAAAGCTAACTTGGTAGTATCTGAAGCATTCGCA AACGAAGGACCAACTATGAAACGTTTCCGTCCACGTGCGAAAGGTTCAGCTTCACCAATC AACAAACGTACAGCTCACATCACTGTAGCTGTTGCAGAAAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P61182 UniProtKB Entry Name RL22_STRPN - General References
- Adrian PV, Zhao W, Black TA, Shaw KJ, Hare RS, Klugman KP: Mutations in ribosomal protein L16 conferring reduced susceptibility to evernimicin (SCH27899): implications for mechanism of action. Antimicrob Agents Chemother. 2000 Mar;44(3):732-8. doi: 10.1128/aac.44.3.732-738.2000. [Article]
- Tettelin H, Nelson KE, Paulsen IT, Eisen JA, Read TD, Peterson S, Heidelberg J, DeBoy RT, Haft DH, Dodson RJ, Durkin AS, Gwinn M, Kolonay JF, Nelson WC, Peterson JD, Umayam LA, White O, Salzberg SL, Lewis MR, Radune D, Holtzapple E, Khouri H, Wolf AM, Utterback TR, Hansen CL, McDonald LA, Feldblyum TV, Angiuoli S, Dickinson T, Hickey EK, Holt IE, Loftus BJ, Yang F, Smith HO, Venter JC, Dougherty BA, Morrison DA, Hollingshead SK, Fraser CM: Complete genome sequence of a virulent isolate of Streptococcus pneumoniae. Science. 2001 Jul 20;293(5529):498-506. [Article]
- Canu A, Malbruny B, Coquemont M, Davies TA, Appelbaum PC, Leclercq R: Diversity of ribosomal mutations conferring resistance to macrolides, clindamycin, streptogramin, and telithromycin in Streptococcus pneumoniae. Antimicrob Agents Chemother. 2002 Jan;46(1):125-31. doi: 10.1128/aac.46.1.125-131.2002. [Article]
- Perez-Trallero E, Marimon JM, Iglesias L, Larruskain J: Fluoroquinolone and macrolide treatment failure in pneumococcal pneumonia and selection of multidrug-resistant isolates. Emerg Infect Dis. 2003 Sep;9(9):1159-62. doi: 10.3201/eid0909.020810. [Article]
- Walsh F, Willcock J, Amyes S: High-level telithromycin resistance in laboratory-generated mutants of Streptococcus pneumoniae. J Antimicrob Chemother. 2003 Sep;52(3):345-53. doi: 10.1093/jac/dkg348. Epub 2003 Aug 13. [Article]