Flavodoxin-1

Details

Name
Flavodoxin-1
Synonyms
Not Available
Gene Name
fldA
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0012127|Flavodoxin-1
MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYG
EAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDALGTIRDIIEPRGATIVGHW
PTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA
Number of residues
176
Molecular Weight
19736.735
Theoretical pI
3.98
GO Classification
Functions
electron carrier activity / FMN binding
Processes
oxidation-reduction process
Components
cytoplasm / cytosol
General Function
Fmn binding
Specific Function
Low-potential electron donor to a number of redox enzymes (Potential). Involved in the reactivation of inactive cob(II)alamin in methionine synthase.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012128|Flavodoxin-1 (fldA)
ATGGCTATCACTGGCATCTTTTTCGGCAGCGACACCGGTAATACCGAAAATATCGCAAAA
ATGATTCAAAAACAGCTTGGTAAAGACGTTGCCGATGTCCATGACATTGCAAAAAGCAGC
AAAGAAGATCTGGAAGCTTATGACATTCTGCTGCTGGGCATCCCAACCTGGTATTACGGC
GAAGCGCAGTGTGACTGGGATGACTTCTTCCCGACTCTCGAAGAGATTGATTTCAACGGC
AAACTGGTTGCGCTGTTTGGTTGTGGTGACCAGGAAGATTACGCCGAATATTTCTGCGAC
GCATTGGGCACCATCCGCGACATCATTGAACCGCGCGGTGCAACCATCGTTGGTCACTGG
CCAACTGCGGGCTATCATTTCGAAGCATCAAAAGGTCTGGCAGATGACGACCACTTTGTC
GGTCTGGCTATCGACGAAGACCGTCAGCCGGAACTGACCGCTGAACGTGTAGAAAAATGG
GTTAAACAGATTTCTGAAGAGTTGCATCTCGACGAAATTCTCAATGCCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP61949
UniProtKB Entry NameFLAV_ECOLI
GenBank Gene IDM59426
General References
  1. Osborne C, Chen LM, Matthews RG: Isolation, cloning, mapping, and nucleotide sequencing of the gene encoding flavodoxin in Escherichia coli. J Bacteriol. 1991 Mar;173(5):1729-37. [PubMed:1999390]
  2. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.: A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. DNA Res. 1996 Jun 30;3(3):137-55. [PubMed:8905232]
  3. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  4. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  5. Jenkins CM, Waterman MR: Flavodoxin and NADPH-flavodoxin reductase from Escherichia coli support bovine cytochrome P450c17 hydroxylase activities. J Biol Chem. 1994 Nov 4;269(44):27401-8. [PubMed:7961651]
  6. VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [PubMed:9298644]
  7. Jarrett JT, Hoover DM, Ludwig ML, Matthews RG: The mechanism of adenosylmethionine-dependent activation of methionine synthase: a rapid kinetic analysis of intermediates in reductive methylation of Cob(II)alamin enzyme. Biochemistry. 1998 Sep 8;37(36):12649-58. [PubMed:9730838]
  8. Ponstingl H, Otting G: NMR assignments, secondary structure and hydration of oxidized Escherichia coli flavodoxin. Eur J Biochem. 1997 Mar 1;244(2):384-99. [PubMed:9119004]
  9. Hoover DM, Ludwig ML: A flavodoxin that is required for enzyme activation: the structure of oxidized flavodoxin from Escherichia coli at 1.8 A resolution. Protein Sci. 1997 Dec;6(12):2525-37. [PubMed:9416602]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails