Vesicle-associated membrane protein 2

Details

Name
Vesicle-associated membrane protein 2
Synonyms
  • SYB2
  • Synaptobrevin-2
  • VAMP-2
Gene Name
VAMP2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016692|Vesicle-associated membrane protein 2
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Number of residues
116
Molecular Weight
12662.585
Theoretical pI
8.48
GO Classification
Functions
calcium-dependent protein binding / calmodulin binding / phospholipid binding / protein self-association / SNAP receptor activity / SNARE binding / syntaxin binding / syntaxin-1 binding
Processes
calcium ion-dependent exocytosis / cellular protein metabolic process / cellular response to insulin stimulus / energy reserve metabolic process / eosinophil degranulation / exocytosis / glutamate secretion / Golgi to plasma membrane protein transport / long-term synaptic potentiation / membrane fusion / membrane organization / neurotransmitter secretion / positive regulation of intracellular protein transport / post-Golgi vesicle-mediated transport / protein complex assembly / protein transport / regulation of delayed rectifier potassium channel activity / regulation of exocytosis / regulation of insulin secretion / regulation of vesicle-mediated transport / response to glucose / small molecule metabolic process / synaptic transmission / synaptic vesicle exocytosis / vesicle fusion / vesicle-mediated transport
Components
cell junction / clathrin-coated vesicle / clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane / clathrin-sculpted glutamate transport vesicle membrane / clathrin-sculpted monoamine transport vesicle membrane / cytoplasmic vesicle / cytosol / extracellular exosome / integral component of plasma membrane / intracellular membrane-bounded organelle / membrane / neuron projection / neuron projection terminus / perinuclear region of cytoplasm / plasma membrane / secretory granule / secretory granule membrane / SNARE complex / storage vacuole / synapse / synaptic vesicle / synaptic vesicle membrane / synaptobrevin 2-SNAP-25-syntaxin-1a complex / synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex / synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex / terminal bouton / trans-Golgi network / vesicle / zymogen granule membrane
General Function
Syntaxin-1 binding
Specific Function
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Pfam Domain Function
Transmembrane Regions
95-114
Cellular Location
Cytoplasmic vesicle
Gene sequence
>lcl|BSEQ0016693|Vesicle-associated membrane protein 2 (VAMP2)
ATGTCTGCTACCGCTGCCACGGCCCCCCCTGCTGCCCCGGCTGGGGAGGGTGGTCCCCCT
GCACCCCCTCCAAACCTCACCAGTAACAGGAGACTGCAGCAGACCCAGGCCCAGGTGGAT
GAGGTGGTGGACATCATGAGGGTGAACGTGGACAAGGTCCTGGAGCGAGACCAGAAGCTG
TCGGAGCTGGACGACCGTGCAGATGCACTCCAGGCGGGGGCCTCCCAGTTTGAAACAAGC
GCAGCCAAGCTCAAGCGCAAATACTGGTGGAAAAACCTCAAGATGATGATCATCTTGGGA
GTGATTTGCGCCATCATCCTCATCATCATCATAGTTTACTTCAGCACTTAA
Chromosome Location
17
Locus
17p13.1
External Identifiers
ResourceLink
UniProtKB IDP63027
UniProtKB Entry NameVAMP2_HUMAN
GenBank Protein ID338632
GenBank Gene IDM36205
GenAtlas IDVAMP2
HGNC IDHGNC:12643
General References
  1. Archer BT 3rd, Ozcelik T, Jahn R, Francke U, Sudhof TC: Structures and chromosomal localizations of two human genes encoding synaptobrevins 1 and 2. J Biol Chem. 1990 Oct 5;265(28):17267-73. [Article]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Jagadish MN, Fernandez CS, Hewish DR, Macaulay SL, Gough KH, Grusovin J, Verkuylen A, Cosgrove L, Alafaci A, Frenkel MJ, Ward CW: Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2. Biochem J. 1996 Aug 1;317 ( Pt 3):945-54. [Article]
  5. Kutay U, Ahnert-Hilger G, Hartmann E, Wiedenmann B, Rapoport TA: Transport route for synaptobrevin via a novel pathway of insertion into the endoplasmic reticulum membrane. EMBO J. 1995 Jan 16;14(2):217-23. [Article]
  6. Fritzius T, Frey AD, Schweneker M, Mayer D, Moelling K: WD-repeat-propeller-FYVE protein, ProF, binds VAMP2 and protein kinase Czeta. FEBS J. 2007 Mar;274(6):1552-66. [Article]
  7. Hanson MA, Stevens RC: Cocrystal structure of synaptobrevin-II bound to botulinum neurotoxin type B at 2.0 A resolution. Nat Struct Biol. 2000 Aug;7(8):687-92. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00042Botulinum toxin type Bapproved, investigationalyesbinderDetails