Retinol-binding protein 5

Details

Name
Retinol-binding protein 5
Synonyms
  • Cellular retinol-binding protein III
  • CRBP-III
  • HRBPiso
Gene Name
RBP5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010475|Retinol-binding protein 5
MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRN
YTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLEL
TARDAVCEQVFRKVR
Number of residues
135
Molecular Weight
15931.17
Theoretical pI
6.51
GO Classification
Functions
retinal binding / retinoid binding / retinol binding / transporter activity
Components
cytoplasm / extracellular exosome
General Function
Transporter activity
Specific Function
Intracellular transport of retinol.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010476|Retinol-binding protein 5 (RBP5)
ATGCCTCCCAACCTCACTGGCTACTACCGCTTTGTCTCGCAGAAGAACATGGAGGACTAC
CTGCAAGCCCTAAACATCAGCTTGGCTGTGCGGAAGATCGCGCTGCTGCTGAAGCCGGAC
AAGGAGATCGAACACCAGGGCAACCACATGACGGTGAGGACGCTCAGCACCTTCCGAAAC
TACACTGTGCAGTTTGATGTGGGAGTGGAGTTTGAGGAGGACCTCAGGAGCGTGGACGGA
CGAAAATGCCAGACCATAGTAACCTGGGAGGAGGAGCACCTGGTGTGTGTGCAGAAAGGG
GAGGTCCCCAACCGGGGCTGGAGACACTGGCTGGAGGGAGAGATGCTGTATCTGGAACTG
ACTGCAAGGGATGCAGTGTGCGAGCAGGTCTTCAGGAAGGTCAGATAG
Chromosome Location
12
Locus
12p13.31
External Identifiers
ResourceLink
UniProtKB IDP82980
UniProtKB Entry NameRET5_HUMAN
GenBank Protein ID13447447
GenBank Gene IDAY007436
GenAtlas IDRBP5
HGNC IDHGNC:15847
General References
  1. Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R: Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein. Proc Natl Acad Sci U S A. 2001 Mar 27;98(7):3710-5. [PubMed:11274389]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Ho JC, Cheung ST, Poon WS, Lee YT, Ng IO, Fan ST: Down-regulation of retinol binding protein 5 is associated with aggressive tumor features in hepatocellular carcinoma. J Cancer Res Clin Oncol. 2007 Dec;133(12):929-36. Epub 2007 May 12. [PubMed:17497168]
  5. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00162Vitamin Aapproved, nutraceutical, vet_approvedunknownbinderDetails
DB06755Beta caroteneapproved, nutraceuticalnosubstrateDetails