Adenylate kinase
Details
- Name
- Adenylate kinase
- Synonyms
- 2.7.4.3
- Adenylate monophosphate kinase
- AK
- ATP-AMP transphosphorylase
- ATP:AMP phosphotransferase
- Gene Name
- adk
- Organism
- Sporosarcina globispora
- Amino acid sequence
>lcl|BSEQ0016363|Adenylate kinase MNIVLMGLPGAGKGTQADRIVEKYGTPHISTGDMFRAAIQEGTELGVKAKSFMDQGALVP DEVTIGIVRERLSKSDCDNGFLLDGFPRTVPQAEALDQLLADMGRKIEHVLNIQVEKEEL IARLTGRRICKVCGTSYHLLFNPPQVEGKCDKDGGELYQRADDNPDTVTNRLEVNMNQTA PLLAFYDSKEVLVNINGQKDIKDVFKDLDVILQGNGQ
- Number of residues
- 217
- Molecular Weight
- 23888.06
- Theoretical pI
- 4.74
- GO Classification
- Functionsadenylate kinase activity / ATP binding / metal ion bindingProcessesAMP salvageComponentscytoplasm
- General Function
- Metal ion binding
- Specific Function
- Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
- Pfam Domain Function
- ADK_lid (PF05191)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P84139 UniProtKB Entry Name KAD_SPOGL - General References
- Bae E, Phillips GN Jr: Structures and analysis of highly homologous psychrophilic, mesophilic, and thermophilic adenylate kinases. J Biol Chem. 2004 Jul 2;279(27):28202-8. Epub 2004 Apr 20. [Article]
- Gilles AM, Glaser P, Perrier V, Meier A, Longin R, Sebald M, Maignan L, Pistotnik E, Barzu O: Zinc, a structural component of adenylate kinases from gram-positive bacteria. J Bacteriol. 1994 Jan;176(2):520-3. [Article]