Pyruvate synthase

Details

Name
Pyruvate synthase
Synonyms
  • 1.2.7.1
  • POR
  • Pyruvate-ferredoxin oxidoreductase.
Gene Name
por
Organism
Desulfovibrio africanus
Amino acid sequence
>lcl|BSEQ0019316|Pyruvate synthase
MGKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIRE
MQSEAGAAGAVHGALAAGALTTTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHA
LSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAIESNVPFMHFFDGFRTSHEI
QKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVP
GIVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLI
KVRLYRPFVSEAFFAALPASAKVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILA
GRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGTSLPVDNAFADTTPKGTIQC
QFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYL
VNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLK
FYNIDAVKIATDVGLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVK
MNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKNVVKPILTQQGDKLPVSAFE
ADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPAN
FTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEY
AARIPVKSEVLPRDSLKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGC
SSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNMSMFARRTHLADLAAKALES
DASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIF
GGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRT
GKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGM
GKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDRS
FPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDT
PMMARPDSGEACDQNRAGTSEQQGDLSKRTKK
Number of residues
1232
Molecular Weight
133679.405
Theoretical pI
6.81
GO Classification
Functions
4 iron, 4 sulfur cluster binding / iron ion binding / pyruvate synthase activity / thiamine pyrophosphate binding
Processes
electron transport chain
Components
cytoplasm
General Function
Thiamine pyrophosphate binding
Specific Function
Catalyzes the ferredoxin-dependent oxidative decarboxylation of pyruvate. Required for the transfer of electrons from pyruvate to ferredoxin (PubMed:9294422, PubMed:7612653). Ferredoxin I and ferredoxin II, which are single 4Fe-4S cluster ferredoxins are the most effective electron carriers of POR (PubMed:7612653).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0005243|3699 bp
ATGGGAAAGAAAATGATGACGACTGATGGCAATACAGCGACAGCGCACGTGGCGTATGCC
ATGAGCGAAGTCGCCGCCATCTACCCCATCACCCCTTCCTCGACCATGGGCGAGGAGGCT
GACGACTGGGCGGCGCAAGGACGCAAGAACATCTTTGGCCAGACCCTGACCATACGCGAA
ATGCAGTCCGAGGCCGGCGCCGCCGGCGCGGTGCACGGGGCCCTGGCGGCCGGCGCCCTG
ACCACGACCTTCACGGCGTCGCAGGGTCTGCTGCTGATGATCCCCAACATGTACAAGATC
TCCGGCGAACTTCTGCCCGGCGTGTTCCACGTCACCGCCCGCGCCATCGCCGCGCACGCC
CTGTCCATCTTCGGTGACCACCAGGATATCTACGCCGCGCGCCAGACAGGCTTCGCCATG
CTCGCCTCCAGCTCGGTGCAGGAGGCCCACGACATGGCCCTGGTGGCCCACTTGGCGGCC
ATCGAGTCCAACGTGCCGTTCATGCACTTCTTCGACGGATTCCGCACCTCGCACGAAATC
CAGAAGATCGAGGTCCTGGACTACGCGGACATGGCCTCGCTGGTGAACCAGAAGGCCCTG
GCGGAATTCCGCGCCAAGTCCATGAACCCCGAGCACCCCCACGTGCGCGGCACGGCCCAG
AACCCCGACATCTACTTCCAGGGTCGCGAGGCAGCCAACCCCTACTACCTCAAGGTGCCC
GGCATCGTTGCCGAGTACATGCAGAAGGTCGCCTCCCTCACGGGCCGCAGCTACAAGCTC
TTTGACTACGTGGGTGCTCCCGACGCCGAGCGCGTCATCGTGTCCATGGGCTCCTCGTGC
GAGACCATCGAGGAGGTCATCAACCACCTCGCGGCCAAGGGCGAAAAGATCGGCCTGATC
AAGGTCCGCCTGTACAGGCCCTTCGTAAGCGAGGCCTTCTTCGCTGCTCTGCCCGCTTCG
GCCAAGGTCATCACGGTCCTCGACCGCACCAAGGAACCCGGCGCGCCCGGCGATCCGCTC
TACCTCGACGTGTGCTCGGCCTTCGTGGAGCGCGGCGAAGCCATGCCCAAGATCCTGGCC
GGCCGCTACGGCCTGGGTTCCAAGGAATTCAGCCCGGCCATGGTCAAGTCCGTGTACGAC
AACATGTCCGGCGCTAAGAAGAACCACTTCACCGTGGGCATCGAAGACGACGTGACCGGC
ACTTCGCTGCCGGTGGACAACGCCTTCGCCGACACCACGCCCAAGGGCACCATCCAGTGC
CAGTTCTGGGGCCTCGGCGCCGACGGCACTGTGGGCGCCAACAAGCAGGCCATCAAGATC
ATCGGCGACAACACGGACCTGTTTGCCCAGGGTTACTTCTCCTACGACTCCAAGAAATCG
GGCGGCATCACCATCTCGCACCTGCGCTTCGGCGAGAAGCCCATCCAGTCCACCTACCTG
GTCAACAGGGCCGACTATGTCGCCTGTCACAACCCGGCCTACGTGGGCATATACGACATC
CTCGAAGGCATCAAGGATGGCGGAACCTTCGTGCTCAACTCGCCTTGGAGCAGCCTCGAG
GACATGGACAAGCACCTGCCCTCCGGCATCAAGCGCACCATCGCGAACAAGAAGCTCAAG
TTCTACAACATCGACGCGGTGAAAATCGCCACCGATGTGGGACTGGGCGGCCGCATCAAC
ATGATCATGCAGACGGCCTTCTTCAAGCTGGCCGGAGTGCTGCCCTTCGAAAAGGCCGTG
GATCTGCTCAAGAAGTCCATCCACAAGGCCTACGGCAAAAAGGGCGAGAAGATCGTCAAG
ATGAACACCGACGCCGTGGACCAGGCCGTCACCTCCCTGCAGGAATTCAAGTATCCGGAT
TCCTGGAAGGACGCTCCCGCTGAGACCAAGGCCGAGCCCATGACGAACGAGTTCTTCAAG
AACGTCGTCAAGCCCATCCTGACCCAGCAGGGCGACAAGCTGCCGGTGAGCGCCTTCGAG
GCCGACGGCCGTTTCCCCCTCGGCACCAGCCAGTTCGAGAAGCGCGGCGTGGCCATCAAC
GTGCCGCAGTGGGTCCCCGAGAACTGCATCCAGTGCAACCAGTGCGCCTTCGTCTGTCCG
CACAGCGCCATCCTGCCCGTGCTGGCCAAGGAAGAGGAGTTGGTCGGCGCGCCGGCGAAC
TTCACGGCCCTGGAAGCCAAGGGCAAGGAGCTCAAGGGCTACAAGTTCCGCATCCAGATC
AACACCCTGGACTGCATGGGCTGCGGCAACTGCGCCGACATCTGTCCGCCCAAGGAAAAG
GCTCTGGTCATGCAGCCCCTGGATACCCAGCGCGACGCGCAGGTGCCCAACCTGGAGTAC
GCAGCGCGCATCCCGGTCAAATCCGAGGTGCTGCCGCGCGACTCGCTCAAGGGCAGCCAG
TTCCAGGAGCCTCTCATGGAATTCTCGGGCGCCTGCTCGGGCTGCGGCGAGACGCCCTAC
GTGCGCGTCATCACCCAGCTCTTCGGCGAGCGCATGTTCATTGCCAACGCCACGGGTTGC
TCGTCCATCTGGGGCGCGTCGGCTCCTTCCATGCCTTACAAGACCAACCGCCTCGGACAA
GGCCCGGCCTGGGGTAACTCCCTGTTCGAAGACGCGGCCGAATACGGCTTCGGCATGAAC
ATGTCCATGTTCGCCCGCCGCACGCATTTGGCCGATCTTGCCGCCAAGGCCCTGGAGAGC
GATGCCTCCGGCGATGTCAAGGAAGCCCTGCAGGGCTGGCTTGCCGGCAAGAACGATCCC
ATCAAGTCCAAGGAATACGGCGACAAGCTCAAGAAGCTGCTGGCTGGTCAGAAGGATGGT
CTGCTCGGACAGATCGCCGCCATGTCCGACCTGTACACCAAGAAGAGCGTGTGGATCTTC
GGTGGCGACGGCTGGGCCTACGACATCGGTTACGGCGGCCTGGACCATGTGCTCGCCTCG
GGCGAGGACGTGAACGTCTTCGTCATGGATACCGAGGTCTACTCCAACACCGGCGGCCAG
TCCTCCAAGGCAACGCCCACGGGCGCCGTGGCCAAGTTCGCGGCGGCCGGCAAGCGTACC
GGCAAGAAGGACCTGGCGCGCATGGTCATGACCTACGGCTACGTCTACGTGGCTACGGTC
TCCATGGGTTACAGCAAGCAGCAGTTCCTCAAGGTGCTCAAGGAAGCCGAAAGCTTCCCC
GGCCCCTCGCTGGTCATCGCCTATGCTACCTGCATCAACCAGGGTCTGCGCAAGGGCATG
GGCAAGAGCCAGGACGTCATGAACACCGCGGTCAAGTCCGGTTACTGGCCGCTGTTCCGC
TACGATCCGCGCTTGGCCGCCCAGGGCAAGAACCCCTTCCAGCTCGACTCCAAGGCTCCT
GACGGTTCCGTCGAGGAGTTCCTGATGGCCCAGAACCGCTTCGCCGTCCTCGATCGGTCC
TTCCCCGAGGACGCCAAGAGACTGCGCGCCCAGGTCGCTCACGAATTGGACGTGCGTTTC
AAGGAGTTGGAGCACATGGCCGCCACGAACATCTTCGAGTCCTTCGCGCCAGCGGGCGGC
AAGGCCGATGGTTCGGTGGATTTCGGCGAAGGTGCGGAGTTCTGCACGCGCGACGATACT
CCCATGATGGCCCGACCTGATTCCGGTGAGGCCTGCGACCAGAACCGCGCTGGCACGAGC
GAACAGCAGGGAGACCTCAGCAAGCGGACGAAGAAGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP94692
UniProtKB Entry NamePOR_DESAF
GenBank Gene IDY09702
General References
  1. Pieulle L, Magro V, Hatchikian EC: Isolation and analysis of the gene encoding the pyruvate-ferredoxin oxidoreductase of Desulfovibrio africanus, production of the recombinant enzyme in Escherichia coli, and effect of carboxy-terminal deletions on its stability. J Bacteriol. 1997 Sep;179(18):5684-92. [PubMed:9294422]
  2. Pieulle L, Guigliarelli B, Asso M, Dole F, Bernadac A, Hatchikian EC: Isolation and characterization of the pyruvate-ferredoxin oxidoreductase from the sulfate-reducing bacterium Desulfovibrio africanus. Biochim Biophys Acta. 1995 Jul 3;1250(1):49-59. [PubMed:7612653]
  3. Chabriere E, Charon MH, Volbeda A, Pieulle L, Hatchikian EC, Fontecilla-Camps JC: Crystal structures of the key anaerobic enzyme pyruvate:ferredoxin oxidoreductase, free and in complex with pyruvate. Nat Struct Biol. 1999 Feb;6(2):182-90. [PubMed:10048931]
  4. Chabriere E, Vernede X, Guigliarelli B, Charon MH, Hatchikian EC, Fontecilla-Camps JC: Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase. Science. 2001 Dec 21;294(5551):2559-63. [PubMed:11752578]
  5. Cavazza C, Contreras-Martel C, Pieulle L, Chabriere E, Hatchikian EC, Fontecilla-Camps JC: Flexibility of thiamine diphosphate revealed by kinetic crystallographic studies of the reaction of pyruvate-ferredoxin oxidoreductase with pyruvate. Structure. 2006 Feb;14(2):217-24. [PubMed:16472741]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01987Cocarboxylaseapproved, experimentalunknownDetails
DB024102-Acetyl-3-[(4-Amino-2-Methyl-5-Pyrimidinyl)Methyl]-4-Methyl-5-(4,6,6-Trihydroxy-3,5-Dioxa-4,6-Diphosphahex-1-Yl)Thiazolium Inner Salt P,P'-DioxideexperimentalunknownDetails
DB00507Nitazoxanideapproved, investigational, vet_approvedyesantagonistinhibitorDetails
DB00507Nitazoxanideapproved, investigational, vet_approvedyesinhibitorDetails