Endoribonuclease EndoA
Details
- Name
- Endoribonuclease EndoA
- Synonyms
- 3.1.27.-
- mazF
- MazF-bs
- mRNA interferase EndoA
- mRNA interferase MazF-bs
- Toxin EndoA
- ydcE
- Gene Name
- ndoA
- Organism
- Bacillus subtilis (strain 168)
- Amino acid sequence
>lcl|BSEQ0011904|Endoribonuclease EndoA MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHV EIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
- Number of residues
- 116
- Molecular Weight
- 12977.845
- Theoretical pI
- 4.88
- GO Classification
- FunctionsDNA binding / endonuclease activity / RNA binding
- General Function
- Rna binding
- Specific Function
- Toxic component of a type II toxin-antitoxin (TA) module. Specific for 5'-UACAU-3' sequences, cleaving after the first U (PubMed:21763692). Yields cleavage products with 3' phosphate and 5' hydroxyl groups (PubMed:15882409). Cannot digest substrate with a UUdUACAUAA cleavage site (PubMed:24120662). Overexpression is toxic for cell growth (shown in E.coli), probably by inhibiting protein synthesis through the cleavage of single-stranded RNA. The toxicity is reversed by the antitoxin EndoAI. Toxin activity cannot be inhibited by MazE from E.coli. The EndoA-EndoAI complex does not seem to bind its own promoter (PubMed:24120662).
- Pfam Domain Function
- PemK_toxin (PF02452)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0011905|Endoribonuclease EndoA (ndoA) TTGATTGTGAAACGCGGCGATGTTTATTTTGCTGATTTATCTCCTGTTGTTGGCTCAGAG CAAGGCGGGGTGCGCCCGGTTTTAGTGATCCAAAATGACATCGGAAATCGCTTCAGCCCA ACTGCTATTGTTGCAGCCATAACAGCACAAATACAGAAAGCGAAATTACCAACCCACGTC GAAATCGATGCAAAACGCTACGGTTTTGAAAGAGATTCCGTTATTTTGCTGGAGCAAATT CGGACGATTGACAAGCAAAGGTTAACGGATAAGATTACTCATCTGGATGATGAAATGATG GATAAGGTTGATGAAGCCTTACAAATCAGTTTGGCACTCATTGATTTTTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P96622 UniProtKB Entry Name ENDOA_BACSU GenBank Gene ID AB001488 - General References
- Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
- Pellegrini O, Mathy N, Gogos A, Shapiro L, Condon C: The Bacillus subtilis ydcDE operon encodes an endoribonuclease of the MazF/PemK family and its inhibitor. Mol Microbiol. 2005 Jun;56(5):1139-48. [Article]
- Park JH, Yamaguchi Y, Inouye M: Bacillus subtilis MazF-bs (EndoA) is a UACAU-specific mRNA interferase. FEBS Lett. 2011 Aug 4;585(15):2526-32. doi: 10.1016/j.febslet.2011.07.008. Epub 2011 Jul 13. [Article]
- Ishida Y, Park JH, Mao L, Yamaguchi Y, Inouye M: Replacement of all arginine residues with canavanine in MazF-bs mRNA interferase changes its specificity. J Biol Chem. 2013 Mar 15;288(11):7564-71. doi: 10.1074/jbc.M112.434969. Epub 2013 Feb 1. [Article]
- Gogos A, Mu H, Bahna F, Gomez CA, Shapiro L: Crystal structure of YdcE protein from Bacillus subtilis. Proteins. 2003 Nov 1;53(2):320-2. [Article]
- Simanshu DK, Yamaguchi Y, Park JH, Inouye M, Patel DJ: Structural basis of mRNA recognition and cleavage by toxin MazF and its regulation by antitoxin MazE in Bacillus subtilis. Mol Cell. 2013 Nov 7;52(3):447-58. doi: 10.1016/j.molcel.2013.09.006. Epub 2013 Oct 10. [Article]