Cytochrome c oxidase subunit 6A2, mitochondrial
Details
- Name
- Cytochrome c oxidase subunit 6A2, mitochondrial
- Synonyms
- COX VIa-M
- COX6A
- COX6AH
- COXVIAH
- Cytochrome c oxidase polypeptide VIa-heart
- Cytochrome c oxidase subunit VIA-muscle
- Gene Name
- COX6A2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0017290|Cytochrome c oxidase subunit 6A2, mitochondrial MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFR PYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
- Number of residues
- 97
- Molecular Weight
- 10815.32
- Theoretical pI
- 11.37
- GO Classification
- Functionscytochrome-c oxidase activityProcessesgeneration of precursor metabolites and energyComponentsmitochondrial respiratory chain complex IV
- General Function
- Cytochrome-c oxidase activity
- Specific Function
- This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
- Pfam Domain Function
- COX6A (PF02046)
- Transmembrane Regions
- Not Available
- Cellular Location
- Mitochondrion inner membrane
- Gene sequence
>lcl|BSEQ0017291|Cytochrome c oxidase subunit 6A2, mitochondrial (COX6A2) ATGGCTTTGCCTCTGAGGCCCCTGACCCGGGGCTTGGCCAGCGCTGCCAAAGGAGGCCAC GGAGGAGCAGGAGCTCGTACCTGGCGTCTGCTGACCTTCGTGCTGGCGCTGCCCAGCGTG GCCCTCTGCACCTTCAACTCCTATCTCCACTCGGGCCACCGCCCGCGCCCCGAGTTCCGT CCCTACCAACACCTCCGCATCCGCACCAAGCCCTACCCCTGGGGGGACGGCAACCACACT CTGTTCCACAATAGCCACGTGAACCCTCTGCCCACGGGCTACGAACACCCCTGA
- Chromosome Location
- 16
- Locus
- 16p
- External Identifiers
Resource Link UniProtKB ID Q02221 UniProtKB Entry Name CX6A2_HUMAN GenBank Protein ID 180946 GenBank Gene ID M83308 HGNC ID HGNC:2279 - General References
- Fabrizi GM, Sadlock J, Hirano M, Mita S, Koga Y, Rizzuto R, Zeviani M, Schon EA: Differential expression of genes specifying two isoforms of subunit VIa of human cytochrome c oxidase. Gene. 1992 Oct 1;119(2):307-12. [Article]
- Bachman NJ, Riggs PK, Siddiqui N, Makris GJ, Womack JE, Lomax MI: Structure of the human gene (COX6A2) for the heart/muscle isoform of cytochrome c oxidase subunit VIa and its chromosomal location in humans, mice, and cattle. Genomics. 1997 May 15;42(1):146-51. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]