Mucin-2

Details

Name
Mucin-2
Synonyms
  • Intestinal mucin-2
  • MUC-2
  • SMUC
Gene Name
MUC2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010723|Mucin-2
MGLPLARLAAVCLALSLAGGSELQTEGRTRYHGRNVCSTWGNFHYKTFDGDVFRFPGLCD
YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNAVVFKSDGSVLLNQLQVNLPHVTA
SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSTCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS
CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR
ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT
RPSTLTTFTTITLPTTPTSFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD
GDREPFDGVCGAPEDIECRSVKDPHLSLEQHGQKVQCDVSVGFICKNEDQFGNGPFGLCY
DYKIRVNCCWPMDKCITTPSPPTTTPSPPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSP
PITTTTTPLPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP
SPPMTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTT
TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP
PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT
PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP
TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFH
KPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGV
IPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPT
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP
ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT
GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT
TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI
TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG
TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT
VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTH
TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPT
TTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSII
RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTP
SPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATCKYNNT
VEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQ
GNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQV
QVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKG
QCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGK
TTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAAL
CAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEG
TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT
HCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWC
ESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELM
EAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNIT
CPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG
SCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCG
LPTGTSRRARRSPRHLGSG
Number of residues
5179
Molecular Weight
540296.38
Theoretical pI
5.63
GO Classification
Processes
cellular protein metabolic process / maintenance of gastrointestinal epithelium / O-glycan processing / post-translational protein modification / protein O-linked glycosylation
Components
Golgi lumen / inner mucus layer / outer mucus layer
General Function
Not Available
Specific Function
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0010724|Mucin-2 (MUC2)
ATGGGGCTGCCACTAGCCCGCCTGGCGGCTGTGTGCCTGGCCCTGTCTTTGGCAGGGGGC
TCGGAGCTCCAGACAGAGGGCAGAACCCGAAACCACGGCCACAACGTCTGCAGCACCTGG
GGCAACTTCCACTACAAGACCTTCGACGGGGACGTCTTCCGCTTCCCCGGCCCCTGCGAC
TACAACTTCGCCTCCGACTGCCGAGGCTCCTACAAGGAATTTGCTGTGCACCTGAAGCGG
GGTCCGGGCCAGGCTGAGGCCCCCGCCGGGGTGGAGTCCATCCTGCTGACCATCAAGGAT
GACACCATCTACCTCACCCGCCACCTGGCTGTGCTTAACGGGGCCGTGGTCAGCACCCCG
CACTACAGCCCCGGGCTGCTCATTGAGAAGAGCGATGCCTACACCAAAGTCTACTCCCGC
GCCGGCCTCACCCTCATGTGGAACCGGGAGGATGCACTCATGCTGGAGCTGGACACTAAG
TTCCGGAACCACACCTGTGGCCTCTGCGGGGACTACAACGGCCTGCAGAGCTATTCAGAA
TTCCTCTCTGACGGCGTGCTCTTCAGTCCCCTGGAGTTTGGGAACATGCAGAAGATCAAC
CAGCCCGATGTGGTGTGTGAGGATCCCGAGGAGGAGGTGGCCCCCGCATCCTGCTCCGAG
CACCGCGCCGAGTGTGAGAGGCTGCTGACCGCCGAGGCCTTCGCGGACTGTCAGGACCTG
GTGCCGCTGGAGCCGTATCTGCGCGCCTGCCAGCAGGACCGCTGCCGGTGCCCGGGCGGT
GACACCTGCGTCTGCAGCACCGTGGCCGAGTTCTCCCGCCAGTGCTCCCACGCCGGCGGC
CGGCCCGGGAACTGGAGGACCGCCACGCTCTGCCCCAAGACCTGCCCCGGGAACCTGGTG
TACCTGGAGAGCGGCTCGCCCTGCATGGACACCTGCTCACACCTGGAGGTGAGCAGCCTG
TGCGAGGAGCACCGCATGGACGGCTGTTTCTGCCCAGAAGGCACCGTATATGACGACATC
GGGGACAGTGGCTGCGTTCCTGTGAGCCAGTGCCACTGCAGGCTGCACGGACACCTGTAC
ACACCGGGCCAGGAGATCACCAATGACTGCGAGCAGTGTGTCTGTAACGCTGGCCGCTGG
GTGTGCAAAGACCTGCCCTGCCCCGGCACCTGTGCCCTGGAAGGCGGCTCCCACATCACC
ACCTTCGATGGGAAGACGTACACCTTCCACGGGGACTGCTACTATGTCCTGGCCAAGGGT
GACCACAACGATTCCTACGCTCTCCTGGGCGAGCTGGCCCCCTGTGGCTCCACAGACAAG
CAGACCTGCCTGAAGACGGTGGTGCTGCTGGCTGACAAGAAGAAGAATGTGGTGGTCTTC
AAGTCCGATGGCAGTGTACTGCTCAACGAGCTGCAGGTGAACCTGCCCCACGTGACCGCG
AGCTTCTCTGTCTTCCGCCCGTCTTCCTACCACATCATGGTGAGCATGGCCATTGGCGTC
CGGCTGCAGGTGCAGCTGGCCCCAGTCATGCAACTCTTTGTGACACTGGACCAGGCCTCC
CAGGGGCAGGTGCAGGGCCTCTGCGGGAACTTCAACGGCCTGGAAGGTGACGACTTCAAG
ACGGCCAGCGGGCTGGTGGAGGCCACGGGGGCCGGCTTTGCCAACACCTGGAAGGCACAG
TCAACCTGCCATGACAAGCTGGACTGGTTGGACGATCCCTGCTCCCTGAACATCGAGAGC
GCCAACTACGCCGAGCACTGGTGCTCCCTCCTGAAGAAGACAGAGACCCCCTTTGGCAGG
TGCCACTCGGCTGTGGACCCTGCTGAGTATTACAAGAGGTGCAAATATGACACGTGTAAC
TGTCAGAACAATGAGGACTGCCTGTGCGCCGCCCTGTCCTCCTACGCGCGCGCCTGCACC
GCCAAGGGCGTCATGCTGTGGGGCTGGCGGGAGCATGTCTGCAACAAGGATGTGGGCTCC
TGCCCCAACTCGCAGGTCTTCCTGTACAACCTGACCACCTGCCAGCAGACCTGCCGCTCC
CTCTCCGAGGCCGACAGCCACTGTCTCGAGGGCTTTGCGCCTGTGGACGGCTGCGGCTGC
CCTGACCACACCTTCCTGGACGAGAAGGGCCGCTGCGTACCCCTGGCCAAGTGCTCCTGT
TACCACCGCGGTCTCTACCTGGAGGCGGGGGACGTGGTCGTCAGGCAGGAAGAACGATGT
GTGTGCCGGGATGGGCGGCTGCACTGTAGGCAGATCCGGCTGATCGGCCAGAGCTGCACG
GCCCCAAAGATCCACATGGACTGCAGCAACCTGACTGCACTGGCCACCTCGAAGCCCCGA
GCCCTCAGCTGCCAGACGCTGGCCGCCGGCTATTACCACACAGAGTGTGTCAGTGGCTGT
GTGTGCCCCGACGGGCTGATGGATGACGGCCGGGGTGGCTGCGTGGTGGAGAAGGAATGC
CCTTGCGTCCATAACAACGACCTGTATTCTTCCGGCGCCAAGATCAAGGTGGACTGCAAT
ACCTGCACCTGCAAGAGAGGACGCTGGGTGTGCACCCAGGCTGTGTGCCATGGCACCTGC
TCCATTTACGGGAGTGGCCACTACATCACCTTTGACGGGAAGTACTACGACTTTGACGGA
CACTGCTCCTACGTGGCTGTTCAGGACTACTGCGGCCAGAACTCCTCACTGGGCTCATTC
AGCATCATCACCGAGAACGTCCCCTGTGGCACTACGGGCGTCACCTGCTCCAAGGCCATC
AAGATCTTCATGGGGAGGACGGAGCTGAAGTTGGAAGACAAGCACCGTGTGGTGATCCAG
CGTGATGAGGGTCACCACGTGGCCTACACCACGCGGGAGGTGGGCCAGTACCTGGTGGTG
GAGTCCAGCACGGGCATCATCGTCATCTGGGACAAGAGGACCACCGTGTTCATCAAGCTG
GCTCCCTCCTACAAGGGCACCGTGTGTGGCCTGTGTGGGAACTTTGACCACCGCTCCAAC
AACGACTTCACCACGCGGGACCACATGGTGGTGAGCAGCGAGCTGGACTTCGGGAACAGC
TGGAAGGAGGCCCCCACCTGCCCAGATGTGAGCACCAACCCCGAGCCCTGCAGCCTGAAC
CCGCACCGCCGCTCCTGGGCCGAGAAGCAGTGCAGCATCCTCAAAAGCAGCGTGTTCAGC
ATCTGCCACAGCAAGGTGGACCCCAAGCCCTTCTACGAGGCCTGTGTGCACGACTCGTGC
TCCTGTGACACGGGTGGGGACTGTGAGTGCTTCTGCTCTGCCGTGGCCTCCTACGCCCAG
GAGTGTACCAAAGAGGGGGCCTGCGTGTTCTGGAGGACGCCGGACCTGTGCCCCATATTC
TGCGACTACTACAACCCTCCGCATGAGTGTGAGTGGCACTATGAGCCATGTGGGAACCGG
AGCTTCGAGACCTGCAGGACCATCAATGGCATCCACTCCAACATCTCCGTGTCCTACCTG
GAGGGCTGCTACCCCCGGTGCCCCAAGGACAGGCCCATCTATGAGGAGGATCTGAAGAAG
TGTGTCACTGCAGACAAGTGTGGCTGCTATGTCGAGGACACCCACTACCCACCTGGAGCA
TCGGTTCCCACCGAGGAGACCTGCAAGTCCTGCGTGTGTACCAACTCCTCCCAAGTCGTC
TGCAGGCCGGAGGAAGGAAAGATTCTTAACCAGACCCAGGATGGCGCCTTCTGCTACTGG
GAGATCTGTGGCCCCAACGGGACGGTGGAGAAGCACTTCAACATCTGTTCCATTACGACA
CGCCCGTCCACCCTGACCACCTTCACCACCATCACCCTCCCCACCACCCCCACCACCTTC
ACCACTACCACCACCACCACCACCCCGACCTCCAGCACAGTTTTATCAACAACTCCGAAG
CTGTGCTGCCTCTGGTCTGACTGGATCAATGAGGACCACCCCAGCAGTGGCAGCGACGAC
GGTGACCGAGAAACATTTGATGGGGTCTGCGGGGCCCCTGAGGACATCGAGTGCAGGTCG
GTCAAGGATCCCCACCTCAGCTTGGAGCAGCTAGGCCAGAAGGTGCAGTGTGATGTCTCT
GTTGGGTTCATTTGCAAGAATGAAGACCAGTTTGGAAATGGACCATTTGGACTGTGTTAC
GACTACAAGATACGTGTCAATTGTTGCTGGCCCATGGATAAGTGTATCACCACTCCCAGC
CCTCCAACTACCACTCCCAGCCCTCCACCAACCAGCACGACCACCCTTCCACCAACCACC
ACCCCCAGCCCTCCAACCACCACCACAACCACCCCTCCACCAACCACCACCCCCAGCCCT
CCAATAACCACCACGACCACCCCTCCACCAACCACCACTCCCAGCCCTCCAATAAGCACC
ACAACCACCCCTCCACCAACCACCACTCCCAGCCCTCCAACCACCACTCCCAGCCCTCCA
ACCACCACTCCCAGCCCTCCAACAACCACCACAACCACCCCTCCACCAACCACCACTCCC
AGCCCTCCAACGACTACGCCCATCACTCCACCAGCCAGCACTACCACCCTTCCACCAACC
ACCACTCCCAGCCCTCCAACAACCACCACAACCACCCCTCCACCAACCACCACTCCCAGT
CCTCCAACGACTACGCCCATCACTCCACCAACCAGCACTACTACCCTTCCACCAACCACC
ACTCCCAGCCCTCCACCAACCACCACAACCACCCCTCCACCAACCACCACTCCCAGCCCT
CCAACAACCACCACTCCCAGTCCTCCAACAATCACCACAACCACCCCTCCACCAACCACC
ACTCCCAGCCCTCCAACAACGACCACAACCACCCCTCCACCAACCACCACTCCCAGCCCT
CCAACGACTACACCCATCACTCCACCAACCAGCACTACCACCCTTCCACCAACCACCACT
CCCAGCCCTCCACCAACCACCACAACCACCCCTCCACCAACCACCACTCCCAGCCCTCCA
ACAACCACCACTCCCAGCCCTCCAATAACCACCACAACCACCCCTCCACCAACCACCACT
CCCAGCTCTCCAATAACCACCACTCCCAGCCCTCCAACAACCACCATGACCACCCCTTCA
CCAACCACCACCCCCAGCTCTCCAATAACCACCACAACCACCCCTTCCTCAACTACCACT
CCCAGCCCTCCACCAACCACCATGACCACCCCTTCACCAACCACCACTCCCAGCCCTCCA
ACAACCACCATGACCACCCTTCCACCAACCACCACTTCCAGCCCTCTAACAACTACTCCT
CTACCTCCATCAATAACTCCTCCTACATTTTCACCATTCTCAACGACAACCCCTACTACC
CCATGCGTGCCTCTCTGCAATTGGACTGGCTGGCTGGATTCTGGAAAACCCAACTTTCAC
AAACCAGGTGGAGACACAGAATTGATTGGAGACGTCTGTGGACCAGGCTGGGCAGCTAAC
ATCTCTTGCAGAGCCACCATGTATCCTGATGTTCCCATTGGACAGCTTGGACAAACAGTG
GTGTGTGATGTCTCTGTGGGGCTGATATGCAAAAATGAAGACCAAAAGCCAGGTGGGGTC
ATCCCTATGGCCTTCTGCCTCAACTACGAGATCAACGTTCAGTGCTGTGAGTGTGTCACC
CAACCCACCACCATGACAACCACCACCACAGAGAACCCAACTCCGCCAACCACGACACCC
ATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACC
ACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAG
ACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACC
GGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCA
ACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACC
CCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACT
ACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACC
ACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACA
CCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCA
ACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACA
CAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCC
ACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACC
CCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTG
ACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACC
ACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATC
ACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACG
ACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACC
CCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGC
ACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACA
CCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCA
ACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACG
GTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACC
ACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCC
ATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACC
ACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAG
ACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACC
GGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCA
ACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACC
CCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACT
ACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACC
ACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACA
CCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCA
ACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACA
CAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCC
ACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACC
CCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTG
ACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACC
ACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATC
ACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACG
ACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACC
CCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGC
ACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACA
CCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCA
ACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACG
GTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACC
ACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCC
ATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACC
ACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAG
ACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACC
GGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCA
ACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACC
CCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACT
ACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACC
ACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACA
CCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCA
ACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACA
CAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCC
ACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACC
CCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTG
ACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACC
ACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATC
ACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACG
ACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACC
CCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGC
ACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACA
CCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCA
ACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACG
GTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACC
ACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCC
ATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACC
ACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAG
ACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACC
GGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCA
ACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACC
CCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACT
ACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACC
ACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACA
CCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCA
ACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACA
CAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCC
ACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACC
CCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTG
ACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACC
ACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATC
ACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACG
ACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACC
CCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGC
ACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACA
CCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCA
ACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACG
GTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACC
ACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCC
ATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACC
ACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAG
ACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACC
GGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCA
ACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACC
CCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACT
ACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACC
ACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACA
CCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCA
ACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACA
CAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCC
ACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACC
CCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTG
ACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACC
ACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATC
ACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACG
ACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACC
CCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACACCCACCGGC
ACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCAACCCCAACA
CCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACGGTGACCCCA
ACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACCACCACTACG
GTGACCCCAACCCCAACACCCACCGGCACACAGACCCCAACCACGACACCCATCACCACC
ACCACTACGGTGACCCCAACCCCAACACCCACCGGCACACAGACCGGGCCCCCCACCCAC
ACAAGCACAGCACCGATTGCTGAGTTGACCACATCCAATCCTCCGCCTGAGTCCTCAACC
CCTCAGACCTCTCGGTCCACCTCTTCCCCTCTCACGGAGTCAACCACCCTTCTGAGTACC
CTACCACCTGCCATTGAGATGACCAGCACGGCCCCACCCTCCACACCCACGGCACCCACG
ACCACGAGCGGAGGCCACACACTGTCTCCACCGCCCAGCACCACCACGTCCCCTCCAGGC
ACCCCCACTCGCGGTACCACGACTGGGTCATCTTCAGCCCCCACCCCCAGCACTGTGCAG
ACGACCACCACCAGTGCCTGGACCCCCACGCCGACCCCACTCTCCACACCCAGCATCATC
AGGACCACAGGCCTGAGGCCCTACCCTTCCTCTGTGCTTATCTGCTGTGTCCTGAACGAC
ACCTACTACGCACCAGGTGAGGAGGTGTACAACGGCACATACGGAGACACCTGTTATTTC
GTCAACTGCTCACTGAGCTGTACGTTGGAGTTCTATAACTGGTCCTGCCCATCCACGCCC
TCCCCAACACCCACGCCCTCCAAGTCGACGCCCACGCCTTCCAAGCCATCGTCCACGCCC
TCCAAGCCGACGCCCGGCACCAAGCCCCCCGAGTGCCCAGACTTTGATCCTCCCAGACAG
GAGAACGAGACTTGGTGGCTGTGCGACTGCTTCATGGCCACGTGCAAGTACAACAACACG
GTGGAGATCGTGAAGGTGGAGTGTGAGCCGCCGCCCATGCCCACCTGCTCCAACGGCCTC
CAACCCGTGCGCGTCGAGGACCCCGACGGCTGCTGCTGGCACTGGGAGTGCGACTGCTAC
TGCACGGGCTGGGGCGACCCGCACTATGTCACCTTCGACGGACTCTACTACAGCTACCAG
GGCAACTGCACCTACGTGCTGGTGGAGGAGATCAGCCCCTCCGTGGACAACTTCGGAGTT
TACATCGACAACTACCACTGCGATCCCAACGACAAGGTGTCCTGCCCCCGCACCCTCATC
GTGCGCCACGAGACCCAGGAGGTGCTGATCAAGACCGTGCATATGATGCCCATGCAGGTG
CAGGTGCAGGTGAACAGGCAGGCGGTGGCACTGCCCTACAAGAAGTACGGGCTGGAGGTG
TACCAGTCTGGCATCAACTACGTGGTGGACATCCCCGAGCTGGGTGTCCTCGTCTCCTAC
AATGGCCTGTCCTTCTCCGTCAGGCTGCCCTACCACCGGTTTGGCAACAACACCAAGGGC
CAGTGTGGCACCTGCACCAACACCACCTCCGACGACTGCATTCTGCCCAGCGGGGAGATC
GTCTCCAACTGTGAGGCTGCGGCTGACCAGTGGCTGGTGAACGACCCCTCCAAGCCACAC
TGCCCCCACAGCAGCTCCACGACCAAGCGCCCGGCCGTCACTGTGCCCGGGGGCGGTAAA
ACGACCCCACACAAGGACTGCACCCCATCTCCCCTCTGCCAGCTCATCAAGGACAGCCTG
TTTGCCCAGTGCCACGCACTGGTGCCCCCGCAGCACTACTACGATGCCTGCGTGTTCGAC
AGCTGCTTCATGCCGGGCTCGAGCCTGGAGTGCGCCAGTCTGCAGGCCTACGCAGCCCTC
TGTGCCCAGCAGAACATCTGCCTCGACTGGCGGAACCACACGCATGGGGCCTGCTTGGTG
GAGTGCCCATCTCACAGGGAGTACCAGGCCTGTGGCCCTGCAGAAGAGCCCACGTGCAAA
TCCAGCTCCTCCCAGCAGAACAACACAGTCCTGGTGGAAGGCTGCTTCTGTCCTGAGGGC
ACCATGAACTACGCTCCTGGCTTTGATGTCTGCGTGAAGACCTGCGGCTGTGTGGGACCT
GACAATGTGCCCAGAGAGTTTGGGGAGCACTTCGAGTTCGACTGCAAGAACTGTGTCTGC
CTGGAGGGTGGAAGTGGCATCATCTGCCAACCCAAGAGGTGCAGCCAGAAGCCCGTTACC
CACTGCGTGGAAGACGGCACCTACCTCGCCACGGAGGTCAACCCTGCCGACACCTGCTGC
AACATTACCGTCTGCAAGTGCAACACCAGCCTGTGCAAAGAGAAGCCCTCCGTGTGCCCG
CTGGGATTCGAAGTGAAGAGCAAGATGGTGCCTGGAAGGTGCTGTCCTTTCTACTGGTGT
GAGTCCAAGGGGGTGTGTGTTCACGGGAATGCTGAGTACCAGCCCGGTTCTCCAGTTTAT
TCCTCCAAGTGCCAGGACTGCGTGTGCACGGACAAGGTGGACAACAACACCCTGCTCAAC
GTCATCGCCTGCACCCACGTGCCCTGCAACACCTCCTGCAGCCCTGGCTTCGAACTCATG
GAGGCCCCCGGGGAGTGCTGTAAGAAGTGTGAACAGACGCACTGTATCATCAAACGGCCC
GACAACCAGCACGTCATCCTGAAGCCCGGGGACTTCAAGAGCGACCCGAAGAACAACTGC
ACATTCTTCAGCTGCGTGAAGATCCACAACCAGCTCATCTCGTCCGTCTCCAACATCACC
TGCCCCAACTTTGATGCCAGCATTTGCATCCCGGGCTCCATCACATTCATGCCCAATGGA
TGCTGCAAGACCTGCACCCCTCGCAATGAGACCAGGGTGCCCTGCTCCACCGTCCCCGTC
ACCACGGAGGTTTCGTACGCCGGCTGCACCAAGACCGTCCTCATGAATCATTGCTCCGGG
TCCTGCGGGACATTTGTCATGTACTCGGCCAAGGCCCAGGCCCTGGACCACAGCTGCTCC
TGCTGCAAAGAGGAGAAAACCAGCCAGCGTGAGGTGGTCCTGAGCTGCCCCAATGGCGGC
TCGCTGACACACACCTACACCCACATCGAGAGCTGCCAGTGCCAGGACACCGTCTGCGGG
CTCCCCACCGGCACCTCCCGCCGGGCCCGGCGCTCCCCTAGGCATCTGGGGAGCGGGTGA
Chromosome Location
11
Locus
11p15.5
External Identifiers
ResourceLink
UniProtKB IDQ02817
UniProtKB Entry NameMUC2_HUMAN
GenBank Protein ID454154
GenBank Gene IDL21998
GenAtlas IDMUC2
HGNC IDHGNC:7512
General References
  1. Gum JR Jr, Hicks JW, Toribara NW, Siddiki B, Kim YS: Molecular cloning of human intestinal mucin (MUC2) cDNA. Identification of the amino terminus and overall sequence similarity to prepro-von Willebrand factor. J Biol Chem. 1994 Jan 28;269(4):2440-6. [Article]
  2. Gum JR Jr, Hicks JW, Toribara NW, Rothe EM, Lagace RE, Kim YS: The human MUC2 intestinal mucin has cysteine-rich subdomains located both upstream and downstream of its central repetitive region. J Biol Chem. 1992 Oct 25;267(30):21375-83. [Article]
  3. Toribara NW, Gum JR Jr, Culhane PJ, Lagace RE, Hicks JW, Petersen GM, Kim YS: MUC-2 human small intestinal mucin gene structure. Repeated arrays and polymorphism. J Clin Invest. 1991 Sep;88(3):1005-13. [Article]
  4. Gum JR, Byrd JC, Hicks JW, Toribara NW, Lamport DT, Kim YS: Molecular cloning of human intestinal mucin cDNAs. Sequence analysis and evidence for genetic polymorphism. J Biol Chem. 1989 Apr 15;264(11):6480-7. [Article]
  5. Xu G, Huan L, Khatri I, Sajjan US, McCool D, Wang D, Jones C, Forstner G, Forstner J: Human intestinal mucin-like protein (MLP) is homologous with rat MLP in the C-terminal region, and is encoded by a gene on chromosome 11 p 15.5. Biochem Biophys Res Commun. 1992 Mar 16;183(2):821-8. [Article]
  6. Silverman HS, Parry S, Sutton-Smith M, Burdick MD, McDermott K, Reid CJ, Batra SK, Morris HR, Hollingsworth MA, Dell A, Harris A: In vivo glycosylation of mucin tandem repeats. Glycobiology. 2001 Jun;11(6):459-71. [Article]
  7. Godl K, Johansson ME, Lidell ME, Morgelin M, Karlsson H, Olson FJ, Gum JR Jr, Kim YS, Hansson GC: The N terminus of the MUC2 mucin forms trimers that are held together within a trypsin-resistant core fragment. J Biol Chem. 2002 Dec 6;277(49):47248-56. Epub 2002 Oct 8. [Article]
  8. Lidell ME, Johansson ME, Hansson GC: An autocatalytic cleavage in the C terminus of the human MUC2 mucin occurs at the low pH of the late secretory pathway. J Biol Chem. 2003 Apr 18;278(16):13944-51. Epub 2003 Feb 11. [Article]
  9. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [Article]
  10. Park SW, Zhen G, Verhaeghe C, Nakagami Y, Nguyenvu LT, Barczak AJ, Killeen N, Erle DJ: The protein disulfide isomerase AGR2 is essential for production of intestinal mucus. Proc Natl Acad Sci U S A. 2009 Apr 28;106(17):6950-5. doi: 10.1073/pnas.0808722106. Epub 2009 Apr 9. [Article]
  11. Johansson ME, Thomsson KA, Hansson GC: Proteomic analyses of the two mucus layers of the colon barrier reveal that their main component, the Muc2 mucin, is strongly bound to the Fcgbp protein. J Proteome Res. 2009 Jul;8(7):3549-57. doi: 10.1021/pr9002504. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01411Pranlukastinvestigationalunknownother/unknownDetails